X-Loop: help-debbugs@HIDDEN
Subject: bug#21840: 24.5; semantic analysis of python files is broken by strings that end in backslash
Resent-From: Glyph Lefkowitz <glyph@HIDDEN>
Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
Resent-CC: bug-gnu-emacs@HIDDEN
Resent-Date: Fri, 06 Nov 2015 02:18:01 +0000
Resent-Message-ID: <handler.21840.B.14467762323174 <at> debbugs.gnu.org>
Resent-Sender: help-debbugs@HIDDEN
X-GNU-PR-Message: report 21840
X-GNU-PR-Package: emacs
X-GNU-PR-Keywords:
To: 21840 <at> debbugs.gnu.org
X-Debbugs-Original-To: bug-gnu-emacs@HIDDEN
Received: via spool by submit <at> debbugs.gnu.org id=B.14467762323174
(code B ref -1); Fri, 06 Nov 2015 02:18:01 +0000
Received: (at submit) by debbugs.gnu.org; 6 Nov 2015 02:17:12 +0000
Received: from localhost ([127.0.0.1]:55144 helo=debbugs.gnu.org)
by debbugs.gnu.org with esmtp (Exim 4.80)
(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
id 1ZuWaV-0000p7-KR
for submit <at> debbugs.gnu.org; Thu, 05 Nov 2015 21:17:12 -0500
Received: from eggs.gnu.org ([208.118.235.92]:48405)
by debbugs.gnu.org with esmtp (Exim 4.80)
(envelope-from <glyph@HIDDEN>) id 1ZuWa9-0000oH-5Q
for submit <at> debbugs.gnu.org; Thu, 05 Nov 2015 21:17:09 -0500
Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71)
(envelope-from <glyph@HIDDEN>) id 1ZuWa7-0003sU-LC
for submit <at> debbugs.gnu.org; Thu, 05 Nov 2015 21:16:48 -0500
X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org
X-Spam-Level:
X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50,T_DKIM_INVALID
autolearn=disabled version=3.3.2
Received: from lists.gnu.org ([2001:4830:134:3::11]:35895)
by eggs.gnu.org with esmtp (Exim 4.71)
(envelope-from <glyph@HIDDEN>) id 1ZuWa7-0003sQ-Hn
for submit <at> debbugs.gnu.org; Thu, 05 Nov 2015 21:16:47 -0500
Received: from eggs.gnu.org ([2001:4830:134:3::10]:58397)
by lists.gnu.org with esmtp (Exim 4.71)
(envelope-from <glyph@HIDDEN>) id 1ZuWa5-0000yn-Tj
for bug-gnu-emacs@HIDDEN; Thu, 05 Nov 2015 21:16:47 -0500
Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71)
(envelope-from <glyph@HIDDEN>) id 1ZuWa0-0003rJ-Q0
for bug-gnu-emacs@HIDDEN; Thu, 05 Nov 2015 21:16:45 -0500
Received: from out3-smtp.messagingengine.com ([66.111.4.27]:46509)
by eggs.gnu.org with esmtp (Exim 4.71)
(envelope-from <glyph@HIDDEN>) id 1ZuWa0-0003qT-JE
for bug-gnu-emacs@HIDDEN; Thu, 05 Nov 2015 21:16:40 -0500
Received: from compute4.internal (compute4.nyi.internal [10.202.2.44])
by mailout.nyi.internal (Postfix) with ESMTP id 31EBC202CD;
Thu, 5 Nov 2015 21:16:34 -0500 (EST)
Received: from frontend1 ([10.202.2.160])
by compute4.internal (MEProxy); Thu, 05 Nov 2015 21:16:34 -0500
DKIM-Signature: v=1; a=rsa-sha1; c=relaxed/relaxed; d=
messagingengine.com; h=content-transfer-encoding:content-type
:date:from:message-id:mime-version:subject:to:x-sasl-enc
:x-sasl-enc; s=smtpout; bh=0H0IbK+N9DmXxl5LOstSmr36zHM=; b=ss161
OHVsaJcyItP1asbKX0p6go9jE2tZ6f49fa0Wb9HInG/LclAXXi1zpxLdU4MT2Hya
EH/2G695D1PLtYN5pdJGkFojE6Fi5WDebBMmz0dHZFrxuZMzDTbS03CK1es0IRqW
3BfMi9h5hc/spGEisKUYkZevNl5aSPwtyUCfb8=
X-Sasl-enc: JcE63sYCTttdyg+3giP4ffHzwVmNOZGo9A06AGvU60Uh 1446776193
Received: from milly.lan (unknown [192.77.237.67])
by mail.messagingengine.com (Postfix) with ESMTPA id B8CADC016DB
for <bug-gnu-emacs@HIDDEN>; Thu, 5 Nov 2015 21:16:33 -0500 (EST)
From: Glyph Lefkowitz <glyph@HIDDEN>
Content-Type: text/plain; charset=us-ascii
Content-Transfer-Encoding: quoted-printable
Message-Id: <F9F51B47-4DF3-4AA6-95CF-C15F9DEAE9D7@HIDDEN>
Date: Thu, 5 Nov 2015 18:16:32 -0800
Mime-Version: 1.0 (Mac OS X Mail 9.1 \(3096.5\))
X-Mailer: Apple Mail (2.3096.5)
X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic]
X-detected-operating-system: by eggs.gnu.org: Error: Malformed IPv6 address
(bad octet value).
X-Received-From: 2001:4830:134:3::11
X-Spam-Score: -5.0 (-----)
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.15
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -5.0 (-----)
Python string literals that end in a backslash cause Semantic's parser
to halt and not recognize anything further in the buffer. I personally
ran across this because I frequently use helm-semantic-or-imenu, but can
be demonstrated equally well by semantic-complete-jump-local or anything
else that makes use of the buffer's symbol list.
The trivial way to reproduce this is to put the string literal "\\" at
the top of a Python buffer and then invoke semantic in one of the ways
just mentioned and notice that nothing is picked up. You can move the
backslash literal down in the file and see every symbol up to the point
where it is placed.
In GNU Emacs 24.5.1 (x86_64-apple-darwin13.4.0, NS apple-appkit-1265.21)
of 2015-04-10 on builder10-9.porkrind.org
Windowing system distributor `Apple', version 10.3.1404
Configured using:
`configure --with-ns '--enable-locallisppath=3D/Library/Application
Support/Emacs/${version}/site-lisp:/Library/Application
Support/Emacs/site-lisp''
Important settings:
locale-coding-system: utf-8-unix
Major mode: Python
Minor modes in effect:
jedi-mode: t
diff-auto-refine-mode: t
global-git-commit-mode: t
flymake-mode: t
quick-hack-python-mode: t
ecb-minor-mode: t
python-docstring-mode: t
server-mode: t
global-undo-tree-mode: t
undo-tree-mode: t
rainbow-identifiers-mode: t
rainbow-delimiters-mode: t
global-auto-complete-mode: t
auto-complete-mode: t
global-quiet-mousewheel-mode: t
quiet-mousewheel-mode: t
obb-mode: t
adaptive-wrap-prefix-mode: t
async-bytecomp-package-mode: t
shell-dirtrack-mode: t
global-semanticdb-minor-mode: t
global-semantic-idle-scheduler-mode: t
semantic-idle-scheduler-mode: t
which-function-mode: t
show-paren-mode: t
semantic-mode: t
icomplete-mode: t
global-auto-revert-mode: t
electric-pair-mode: t
delete-selection-mode: t
tooltip-mode: t
electric-indent-mode: t
menu-bar-mode: t
file-name-shadow-mode: t
global-font-lock-mode: t
font-lock-mode: t
blink-cursor-mode: t
auto-composition-mode: t
auto-encryption-mode: t
auto-compression-mode: t
temp-buffer-resize-mode: t
column-number-mode: t
line-number-mode: t
transient-mark-mode: t
Recent messages:
Mark set [2 times]
Saving file =
/Users/glyph/Projects/Twisted/twisted/internet/test/test_endpoints.py...
Wrote =
/Users/glyph/Projects/Twisted/twisted/internet/test/test_endpoints.py
Mark set [3 times]
Saving file =
/Users/glyph/Projects/Twisted/twisted/internet/test/test_endpoints.py...
Wrote =
/Users/glyph/Projects/Twisted/twisted/internet/test/test_endpoints.py
Mark set
"Beep."
Quit
"Beep."
Quit
Load-path shadows:
/Users/glyph/.emacs.d/elpa/helm-20151028.327/helm-multi-match hides =
/Users/glyph/.emacs.d/elpa/helm-core-20151024.2233/helm-multi-match
Features:
(shadow sort mail-extr semantic/complete eieio-opt find-func emacsbug
sendmail ido noutline outline mm-archive url-http url-gw url-cache
url-auth url-handlers epg finder-inf inversion semantic/tag-write tabify
misearch multi-isearch semantic/edit network-stream starttls tls
semantic/tag-file helm-semantic semantic/imenu semantic/sb vc-git
semantic/db-file data-debug cedet-files semantic/wisent/python
semantic/decorate/include semantic/decorate/mode semantic/decorate pulse
semantic/dep semantic/wisent/python-wy semantic/wisent
semantic/wisent/wisent flyflakes jedi jedi-core python-environment epc
ctable concurrent deferred ropemacs pymacs column-marker magit-svn linum
magit-blame magit-stash magit-bisect magit-remote magit-commit
magit-sequence magit magit-apply magit-wip magit-log magit-diff
smerge-mode diff-mode magit-core magit-process magit-popup magit-mode
help-mode magit-git crm magit-section magit-utils git-commit log-edit
message rfc822 mml mml-sec mm-decode mm-bodies mm-encode mail-parse
rfc2231 rfc2047 rfc2045 ietf-drums mailabbrev mail-utils gmm-utils
mailheader pcvs-util add-log with-editor tramp-sh dash winner mule-util
flymake python-patches python json quickhack ecb-layout-defs cus-edit
warnings ecb ecb-symboldef ecb-analyse ecb-compatibility
ecb-winman-support ecb-autogen autoload lisp-mnt ecb-tod ecb-cycle
ecb-eshell ecb-help ecb-jde ecb-method-browser hideshow
ecb-semantic-wrapper ecb-semantic ecb-file-browser ecb-speedbar
ecb-layout ecb-create-layout ecb-compilation ecb-common-browser speedbar
sb-image dframe ecb-navigate ecb-mode-line ecb-face tree-buffer
ecb-upgrade ecb-cedet-wrapper semantic/db-find semantic/db-ref
semantic/analyze semantic/sort semantic/scope semantic/analyze/fcn
wid-edit ecb-util python-docstring server undo-tree diff pelican-mode
rainbow-identifiers color rainbow-delimiters disp-table
auto-complete-config auto-complete popup quiet-mousewheel-mode
backandforth obb-mode combinator goto-definition adaptive-wrap
helm-C-x-b helm-imenu helm-command helm-elisp helm-eval edebug eldoc
helm-mode helm-cmd-t helm-files rx image-dired dired-x dired-aux ffap
thingatpt helm-buffers helm-elscreen helm-tags helm-bookmark
helm-adaptive helm-info bookmark pp helm-locate helm-grep helm-regexp
helm-plugin helm-external helm-net browse-url xml url url-proxy
url-privacy url-expand url-methods url-history url-cookie url-domsuf
url-util url-parse url-vars mailcap helm-utils compile helm-help
helm-types helm easy-mmode helm-source helm-multi-match helm-lib dired
helm-config helm-easymenu edmacro kmacro async-bytecomp async
helm-aliases tramp tramp-compat auth-source gnus-util mm-util mail-prsvr
password-cache tramp-loaddefs trampver shell pcomplete comint ansi-color
ring format-spec semantic/db-mode semantic/db eieio-base semantic/idle
semantic/format ezimage semantic/tag-ls semantic/find semantic/ctxt
jka-compr vale-theme which-func imenu paren semantic/util-modes
semantic/util semantic semantic/tag semantic/lex semantic/fw eieio
byte-opt bytecomp byte-compile cl-extra cconv eieio-core mode-local
cedet icomplete autorevert filenotify elec-pair delsel cus-start
cus-load info easymenu package epg-config glyph-setup advice help-fns
cl-macs cl cl-loaddefs cl-lib gv time-date tooltip electric uniquify
ediff-hook vc-hooks lisp-float-type mwheel ns-win tool-bar dnd fontset
image regexp-opt fringe tabulated-list newcomment lisp-mode prog-mode
register page menu-bar rfn-eshadow timer select scroll-bar mouse
jit-lock font-lock syntax facemenu font-core frame cham georgian
utf-8-lang misc-lang vietnamese tibetan thai tai-viet lao korean
japanese hebrew greek romanian slovak czech european ethiopic indian
cyrillic chinese case-table epa-hook jka-cmpr-hook help simple abbrev
minibuffer nadvice loaddefs button faces cus-face macroexp files
text-properties overlay sha1 md5 base64 format env code-pages mule
custom widget hashtable-print-readable backquote make-network-process
cocoa ns multi-tty emacs)
Memory information:
((conses 16 1026645 103760)
(symbols 48 50999 14)
(miscs 40 2212 1016)
(strings 32 133794 14262)
(string-bytes 1 4110532)
(vectors 16 54622)
(vector-slots 8 1559457 187147)
(floats 8 753 1789)
(intervals 56 121346 2669)
(buffers 960 34))
Content-Disposition: inline Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-Mailer: MIME-tools 5.503 (Entity 5.503) Content-Type: text/plain; charset=utf-8 X-Loop: help-debbugs@HIDDEN From: help-debbugs@HIDDEN (GNU bug Tracking System) To: Glyph Lefkowitz <glyph@HIDDEN> Subject: bug#21840: Acknowledgement (24.5; semantic analysis of python files is broken by strings that end in backslash) Message-ID: <handler.21840.B.14467762323174.ack <at> debbugs.gnu.org> References: <F9F51B47-4DF3-4AA6-95CF-C15F9DEAE9D7@HIDDEN> X-Gnu-PR-Message: ack 21840 X-Gnu-PR-Package: emacs Reply-To: 21840 <at> debbugs.gnu.org Date: Fri, 06 Nov 2015 02:18:02 +0000 Thank you for filing a new bug report with debbugs.gnu.org. This is an automatically generated reply to let you know your message has been received. Your message is being forwarded to the package maintainers and other interested parties for their attention; they will reply in due course. Your message has been sent to the package maintainer(s): bug-gnu-emacs@HIDDEN If you wish to submit further information on this problem, please send it to 21840 <at> debbugs.gnu.org. Please do not send mail to help-debbugs@HIDDEN unless you wish to report a problem with the Bug-tracking system. --=20 21840: http://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D21840 GNU Bug Tracking System Contact help-debbugs@HIDDEN with problems
X-Loop: help-debbugs@HIDDEN
Subject: bug#21840: 24.5; semantic analysis of python files is broken by strings that end in backslash
Resent-From: Lars Ingebrigtsen <larsi@HIDDEN>
Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
Resent-CC: bug-gnu-emacs@HIDDEN
Resent-Date: Thu, 03 Dec 2020 10:47:01 +0000
Resent-Message-ID: <handler.21840.B21840.160699237711792 <at> debbugs.gnu.org>
Resent-Sender: help-debbugs@HIDDEN
X-GNU-PR-Message: followup 21840
X-GNU-PR-Package: emacs
X-GNU-PR-Keywords:
To: Glyph Lefkowitz <glyph@HIDDEN>
Cc: 21840 <at> debbugs.gnu.org
Received: via spool by 21840-submit <at> debbugs.gnu.org id=B21840.160699237711792
(code B ref 21840); Thu, 03 Dec 2020 10:47:01 +0000
Received: (at 21840) by debbugs.gnu.org; 3 Dec 2020 10:46:17 +0000
Received: from localhost ([127.0.0.1]:38554 helo=debbugs.gnu.org)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
id 1kkm7t-000348-Cc
for submit <at> debbugs.gnu.org; Thu, 03 Dec 2020 05:46:17 -0500
Received: from quimby.gnus.org ([95.216.78.240]:44492)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <larsi@HIDDEN>) id 1kkm7r-00033t-Q6
for 21840 <at> debbugs.gnu.org; Thu, 03 Dec 2020 05:46:16 -0500
DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnus.org;
s=20200322; h=Content-Type:MIME-Version:Message-ID:In-Reply-To:Date:
References:Subject:Cc:To:From:Sender:Reply-To:Content-Transfer-Encoding:
Content-ID:Content-Description:Resent-Date:Resent-From:Resent-Sender:
Resent-To:Resent-Cc:Resent-Message-ID:List-Id:List-Help:List-Unsubscribe:
List-Subscribe:List-Post:List-Owner:List-Archive;
bh=H4anIzEju3/h6J2SDzAwcfO57VmAuX/L6OmS9XSCRiA=; b=mIN9i4PPHNKIDtFzuWY6vEgy8r
CuyJzBoBtjj0mPveO3ZgMCsmD/jI7NMZo+8waKB68y+VEfWMygJ7wv44itMAczi+KXlZL8Qr08/XG
uKopuO8YBfFY1fYv7sRUNGm6iqSyYCngWS7R/OMrbK4EE8KjEWxxINI7uezqJsnuH8H4=;
Received: from cm-84.212.202.86.getinternet.no ([84.212.202.86] helo=xo)
by quimby.gnus.org with esmtpsa (TLS1.3:ECDHE_RSA_AES_256_GCM_SHA384:256)
(Exim 4.92) (envelope-from <larsi@HIDDEN>)
id 1kkm7j-0002SQ-Ef; Thu, 03 Dec 2020 11:46:09 +0100
From: Lars Ingebrigtsen <larsi@HIDDEN>
References: <F9F51B47-4DF3-4AA6-95CF-C15F9DEAE9D7@HIDDEN>
X-Now-Playing: Mentol Nomad's _Firecamp Stories Remixes_: "Veil of Light"
Date: Thu, 03 Dec 2020 11:46:06 +0100
In-Reply-To: <F9F51B47-4DF3-4AA6-95CF-C15F9DEAE9D7@HIDDEN> (Glyph
Lefkowitz's message of "Thu, 5 Nov 2015 18:16:32 -0800")
Message-ID: <875z5jupzl.fsf@HIDDEN>
User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/28.0.50 (gnu/linux)
MIME-Version: 1.0
Content-Type: text/plain
X-Spam-Report: Spam detection software, running on the system "quimby.gnus.org",
has NOT identified this incoming email as spam. The original
message has been attached to this so you can view it or label
similar future email. If you have any questions, see
@@CONTACT_ADDRESS@@ for details.
Content preview: Glyph Lefkowitz <glyph@HIDDEN> writes: > Python
string literals that end in a backslash cause Semantic's parser > to halt
and not recognize anything further in the buffer. I personally > ran across
this because I frequently use helm-semant [...]
Content analysis details: (-2.9 points, 5.0 required)
pts rule name description
---- ---------------------- --------------------------------------------------
-1.0 ALL_TRUSTED Passed through trusted hosts only via SMTP
-1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1%
[score: 0.0000]
X-Spam-Score: 0.0 (/)
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -1.0 (-)
Glyph Lefkowitz <glyph@HIDDEN> writes:
> Python string literals that end in a backslash cause Semantic's parser
> to halt and not recognize anything further in the buffer. I personally
> ran across this because I frequently use helm-semantic-or-imenu, but can
> be demonstrated equally well by semantic-complete-jump-local or anything
> else that makes use of the buffer's symbol list.
>
> The trivial way to reproduce this is to put the string literal "\\" at
> the top of a Python buffer and then invoke semantic in one of the ways
> just mentioned and notice that nothing is picked up. You can move the
> backslash literal down in the file and see every symbol up to the point
> where it is placed.
(This bug report unfortunately got no response at the time.)
Do you have a step-by-step recipe to reproduce this bug, starting from
"emacs -Q"?
--
(domestic pets only, the antidote for overdose, milk.)
bloggy blog: http://lars.ingebrigtsen.no
Received: (at control) by debbugs.gnu.org; 3 Dec 2020 10:46:24 +0000 From debbugs-submit-bounces <at> debbugs.gnu.org Thu Dec 03 05:46:24 2020 Received: from localhost ([127.0.0.1]:38557 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1kkm80-00034T-LL for submit <at> debbugs.gnu.org; Thu, 03 Dec 2020 05:46:24 -0500 Received: from quimby.gnus.org ([95.216.78.240]:44506) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <larsi@HIDDEN>) id 1kkm7y-000347-CX for control <at> debbugs.gnu.org; Thu, 03 Dec 2020 05:46:22 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnus.org; s=20200322; h=Subject:From:To:Message-Id:Date:Sender:Reply-To:Cc: MIME-Version:Content-Type:Content-Transfer-Encoding:Content-ID: Content-Description:Resent-Date:Resent-From:Resent-Sender:Resent-To:Resent-Cc :Resent-Message-ID:In-Reply-To:References:List-Id:List-Help:List-Unsubscribe: List-Subscribe:List-Post:List-Owner:List-Archive; bh=bprqQBZNYKm14jWpypVJadXS9NY3JrY/40MPZXeetV8=; b=GfV31Q9cAGFuitPYDoCitLUrWs M83DZHovEhFgwG6oGYaLxIvTY2CdaeH9lxukVZ0uGbak3FkMA6rx1Q1MZcuODPIL2BPgSyWE7ZWXh 1ie6C4iYJxRH/1ZTOWxDVxIRVcfyrBK4Oe3IZZ5S3WKl7Nb6RiSijvjHZgWPb6mNm8c8=; Received: from cm-84.212.202.86.getinternet.no ([84.212.202.86] helo=xo) by quimby.gnus.org with esmtpsa (TLS1.3:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.92) (envelope-from <larsi@HIDDEN>) id 1kkm7q-0002Sb-K9 for control <at> debbugs.gnu.org; Thu, 03 Dec 2020 11:46:16 +0100 Date: Thu, 03 Dec 2020 11:46:13 +0100 Message-Id: <874kl3upze.fsf@HIDDEN> To: control <at> debbugs.gnu.org From: Lars Ingebrigtsen <larsi@HIDDEN> Subject: control message for bug #21840 X-Spam-Report: Spam detection software, running on the system "quimby.gnus.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: tags 21840 + moreinfo quit Content analysis details: (-2.9 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -1.0 ALL_TRUSTED Passed through trusted hosts only via SMTP -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% [score: 0.0000] X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: control X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) tags 21840 + moreinfo quit
X-Loop: help-debbugs@HIDDEN
Subject: bug#21840: 24.5; semantic analysis of python files is broken by strings that end in backslash
Resent-From: Glyph <glyph@HIDDEN>
Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
Resent-CC: bug-gnu-emacs@HIDDEN
Resent-Date: Thu, 03 Dec 2020 18:50:02 +0000
Resent-Message-ID: <handler.21840.B21840.160702135212867 <at> debbugs.gnu.org>
Resent-Sender: help-debbugs@HIDDEN
X-GNU-PR-Message: followup 21840
X-GNU-PR-Package: emacs
X-GNU-PR-Keywords: moreinfo
To: Lars Ingebrigtsen <larsi@HIDDEN>
Cc: 21840 <at> debbugs.gnu.org
Received: via spool by 21840-submit <at> debbugs.gnu.org id=B21840.160702135212867
(code B ref 21840); Thu, 03 Dec 2020 18:50:02 +0000
Received: (at 21840) by debbugs.gnu.org; 3 Dec 2020 18:49:12 +0000
Received: from localhost ([127.0.0.1]:41790 helo=debbugs.gnu.org)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
id 1kktfE-0003LT-F1
for submit <at> debbugs.gnu.org; Thu, 03 Dec 2020 13:49:12 -0500
Received: from so254-45.mailgun.net ([198.61.254.45]:39382)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <bounce+7342ff.9f5a2-21840=debbugs.gnu.org@HIDDEN>)
id 1kktfA-0003LB-7y
for 21840 <at> debbugs.gnu.org; Thu, 03 Dec 2020 13:49:11 -0500
DKIM-Signature: a=rsa-sha256; v=1; c=relaxed/relaxed; d=twistedmatrix.com;
q=dns/txt; s=smtp; t=1607021350; h=To: References: Message-Id:
Content-Transfer-Encoding: Cc: Date: In-Reply-To: From: Subject:
Mime-Version: Content-Type: Sender;
bh=eUxp5Y1LS+yarGs6MRqRBq/Nrd/oRThQcXrcg0IZceg=;
b=KR/iajFLJxZFACOSzWOCCKY7XAA1zBVfm6YDqepImktObSSaFDDl09RQyDUdtpokIYZlYx6l
kSAC4SP7oEeCfOKx52e502hBRDpm8j+X+ydaVxE8KYLv0p87CNsbqUQ0IBn6XgLvq1vblt5L
yrCM41mCukQ6lPb95cx9Lq99iK0=
X-Mailgun-Sending-Ip: 198.61.254.45
X-Mailgun-Sid: WyI3NDE1MCIsICIyMTg0MEBkZWJidWdzLmdudS5vcmciLCAiOWY1YTIiXQ==
Received: from auth1-smtp.messagingengine.com
(auth1-smtp.messagingengine.com [66.111.4.227]) by
smtp-out-n08.prod.us-west-2.postgun.com with SMTP id
5fc93315ca03b1496587c42f (version=TLS1.2,
cipher=TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256); Thu, 03 Dec 2020 18:48:53
GMT
Received: from compute3.internal (compute3.nyi.internal [10.202.2.43])
by mailauth.nyi.internal (Postfix) with ESMTP id D206727C0054;
Thu, 3 Dec 2020 13:48:52 -0500 (EST)
Received: from mailfrontend1 ([10.202.2.162])
by compute3.internal (MEProxy); Thu, 03 Dec 2020 13:48:52 -0500
X-ME-Sender: <xms:FDPJX3giKFXRYeCPu8DIh_ePAb8DruDejC7iMXlxkD18YpGR6m_x1g>
<xme:FDPJX0CZpG_hMV_psEPznnUci4Dt5poNO9XlQZxsIyGA1Szyhd1rbBly5szLrYON0
FzVLpcq-C0zCl2yUg>
X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedujedrudeiiedguddukecutefuodetggdotefrod
ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfgh
necuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmd
enucfjughrpegtggfuhfgjfffgkfhfvffosehtqhhmtdhhtddvnecuhfhrohhmpefilhih
phhhuceoghhlhihphhesthifihhsthgvughmrghtrhhigidrtghomheqnecuggftrfgrth
htvghrnhepkeetueduhfffffdvvdfhvdetgeevfeevgfeikeeukeefteffgfdvudduvefg
ueeunecuffhomhgrihhnpehinhhgvggsrhhighhtshgvnhdrnhhonecukfhppeejiedrvd
dviedrudeifedrvdeffeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgr
ihhlfhhrohhmpehglhihphhhodhmvghsmhhtphgruhhthhhpvghrshhonhgrlhhithihqd
efjeegtddufeejjedqudegleeliedvkeelqdhglhihphhhpeepthifihhsthgvughmrght
rhhigidrtghomhesfhgrshhtmhgrihhlrdgtohhm
X-ME-Proxy: <xmx:FDPJX3EYJSkrTkPJ--yL-e6zf4MS67iMDHIyFMjEhf1IrRm6IaKd_g>
<xmx:FDPJX0Ra0KMz6wAI9Iz7y2tmD743-0TqR5TYkarmdVZr2GW4mKuv-Q>
<xmx:FDPJX0xLw1sBXVIHCwFO_IkNymuxg9Ge3q0TqqXsDdfpnEGVDMU5NQ>
<xmx:FDPJXxu0avU8s9AXic2S3iNxTmJTYtECWvtkcZJmihYHpsFDkM1Jug>
Received: from elara.lan.glyph.im
(76-226-163-233.lightspeed.sntcca.sbcglobal.net [76.226.163.233])
by mail.messagingengine.com (Postfix) with ESMTPA id 3A98524005B;
Thu, 3 Dec 2020 13:48:52 -0500 (EST)
Content-Type: text/plain;
charset=us-ascii
Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.20.0.2.21\))
From: Glyph <glyph@HIDDEN>
In-Reply-To: <875z5jupzl.fsf@HIDDEN>
Date: Thu, 3 Dec 2020 10:48:50 -0800
Content-Transfer-Encoding: quoted-printable
Message-Id: <F14250C1-2503-4022-9D9B-911D9EC0F5BA@HIDDEN>
References: <F9F51B47-4DF3-4AA6-95CF-C15F9DEAE9D7@HIDDEN>
<875z5jupzl.fsf@HIDDEN>
X-Mailer: Apple Mail (2.3654.20.0.2.21)
X-Spam-Score: -0.0 (/)
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -1.0 (-)
I don't know how to force semantic to fully reparse a file, I just =
observe its behavior in response to idle times.
Here's a test file you can use though, if you know how to do that:
def a(v):
"test"
def x():
"test"
a(b"\\")
def y():
"test"
def z():
"test"
Comment and uncomment the 'a(b"\\")' line and let semantic get around to =
reparsing the buffer, however it decides to do that, and (mapcar 'car =
(semantic-fetch-tags)) will return ("a" "x") rather than the expected =
("a" "x" "y" "z"). However, it seems like there's tons of cache state =
somewhere that I can't easily clear out because it randomly seems to =
fluctuate between doing what I expect, returning "nil", and returning a =
stale copy of the symbols (including stuff added and then removed =
entirely from the bottom of the buffer).
Sadly, given that I don't use semantic any more (specifically because of =
this type of inscrutable unreliability) I don't have any more time for =
debugging this. Thanks for following up and good luck!
-g
> On Dec 3, 2020, at 2:46 AM, Lars Ingebrigtsen <larsi@HIDDEN> wrote:
>=20
> Glyph Lefkowitz <glyph@HIDDEN> writes:
>=20
>> Python string literals that end in a backslash cause Semantic's =
parser
>> to halt and not recognize anything further in the buffer. I =
personally
>> ran across this because I frequently use helm-semantic-or-imenu, but =
can
>> be demonstrated equally well by semantic-complete-jump-local or =
anything
>> else that makes use of the buffer's symbol list.
>>=20
>> The trivial way to reproduce this is to put the string literal "\\" =
at
>> the top of a Python buffer and then invoke semantic in one of the =
ways
>> just mentioned and notice that nothing is picked up. You can move =
the
>> backslash literal down in the file and see every symbol up to the =
point
>> where it is placed.
>=20
> (This bug report unfortunately got no response at the time.)
>=20
> Do you have a step-by-step recipe to reproduce this bug, starting from
> "emacs -Q"?
>=20
> --=20
> (domestic pets only, the antidote for overdose, milk.)
> bloggy blog: http://lars.ingebrigtsen.no
X-Loop: help-debbugs@HIDDEN
Subject: bug#21840: 24.5; semantic analysis of python files is broken by strings that end in backslash
Resent-From: Lars Ingebrigtsen <larsi@HIDDEN>
Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
Resent-CC: bug-gnu-emacs@HIDDEN
Resent-Date: Fri, 04 Dec 2020 09:55:02 +0000
Resent-Message-ID: <handler.21840.B21840.16070756838043 <at> debbugs.gnu.org>
Resent-Sender: help-debbugs@HIDDEN
X-GNU-PR-Message: followup 21840
X-GNU-PR-Package: emacs
X-GNU-PR-Keywords: moreinfo
To: Glyph <glyph@HIDDEN>
Cc: 21840 <at> debbugs.gnu.org
Received: via spool by 21840-submit <at> debbugs.gnu.org id=B21840.16070756838043
(code B ref 21840); Fri, 04 Dec 2020 09:55:02 +0000
Received: (at 21840) by debbugs.gnu.org; 4 Dec 2020 09:54:43 +0000
Received: from localhost ([127.0.0.1]:42738 helo=debbugs.gnu.org)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
id 1kl7nX-00025f-2Z
for submit <at> debbugs.gnu.org; Fri, 04 Dec 2020 04:54:43 -0500
Received: from quimby.gnus.org ([95.216.78.240]:56556)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <larsi@HIDDEN>) id 1kl7nV-00025R-NZ
for 21840 <at> debbugs.gnu.org; Fri, 04 Dec 2020 04:54:42 -0500
DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnus.org;
s=20200322; h=Content-Type:MIME-Version:Message-ID:In-Reply-To:Date:
References:Subject:Cc:To:From:Sender:Reply-To:Content-Transfer-Encoding:
Content-ID:Content-Description:Resent-Date:Resent-From:Resent-Sender:
Resent-To:Resent-Cc:Resent-Message-ID:List-Id:List-Help:List-Unsubscribe:
List-Subscribe:List-Post:List-Owner:List-Archive;
bh=M/pEPxSbxkAe8RqM8KJGDa163GzNl4mcPZoVZC9D+FE=; b=gr67LHylinLLRiMY47EsszcH7U
u6dddBkjK6oNs/pOIpBQULBqcK4gJqlinx/340e8SoET59XH4xdRLpvqfkKmzaHHAMuRLW4tWSusu
pyxv5EBDAiWDWkyI675Q7igw6J1CiPcDKn2ioPQhR3QCf9w07HneJT3o+OfQOTpSSYcI=;
Received: from cm-84.212.202.86.getinternet.no ([84.212.202.86] helo=xo)
by quimby.gnus.org with esmtpsa (TLS1.3:ECDHE_RSA_AES_256_GCM_SHA384:256)
(Exim 4.92) (envelope-from <larsi@HIDDEN>)
id 1kl7nN-0006xa-5E; Fri, 04 Dec 2020 10:54:35 +0100
From: Lars Ingebrigtsen <larsi@HIDDEN>
References: <F9F51B47-4DF3-4AA6-95CF-C15F9DEAE9D7@HIDDEN>
<875z5jupzl.fsf@HIDDEN>
<F14250C1-2503-4022-9D9B-911D9EC0F5BA@HIDDEN>
Face: iVBORw0KGgoAAAANSUhEUgAAADAAAAAwBAMAAAClLOS0AAAABGdBTUEAALGPC/xhBQAAACBj
SFJNAAB6JgAAgIQAAPoAAACA6AAAdTAAAOpgAAA6mAAAF3CculE8AAAAHlBMVEU4Xo1JbpdNdaBg
j62aqrbv8+MtRnXZtYAnN2H///+0oGb7AAAAAWJLR0QJ8dml7AAAAAd0SU1FB+QMBAggJkIJeYUA
AAGASURBVDjLdZNLTsQwDIZTCc16DFyg7g2aIPbTVByAZt9VNXuQ5gYox8aPPCvwLEb1l992HNsY
YwDgGSerhvQF5DTXQfxoM8AEYIDnsQrsjCPAVeMgVgGRUSUcBquAJSASOd8IUvqrgqkFkgVM63dL
JRk47xbvl5omARfC5gvgyySwhhD8ui0lDRqNFNS2WprJkdRaMNMlCvAVaKkZLI2C/3wGa9LMnKOJ
JCIuOoG30Nun1XLn9QRCAnhWhBuF4ocN/4Cn8FcoepHXs3/jJhoaBud8Y9p3s8swtG/O9x6Bx+T0
5uIXQFP1zX2hFnxZ+76oX+p9YfBBTgU0JIMA0E6qwt1QJlFH+pQhjWgPUEpSSQfmBnAOVwQICdCG
EHjo8Yn9lOJidm4K2umRB0q346CfrkIf6EJgL0siprUyYMmga4Vjznww2JUQk4UdRMBANHJR3bEE
YgJUNh0u/ruJlRQ7FMSfE2FBZBCPTsRfUYGQvRxnQQIcrbVYQE/uDegQf/4CJrPmcJViBpAAAAAl
dEVYdGRhdGU6Y3JlYXRlADIwMjAtMTItMDRUMDg6MzI6MzgrMDA6MDCzCjsXAAAAJXRFWHRkYXRl
Om1vZGlmeQAyMDIwLTEyLTA0VDA4OjMyOjM4KzAwOjAwwleDqwAAAABJRU5ErkJggg==
X-Now-Playing: Edh's =?UTF-8?Q?=5FV=C3=A4nskap?= 002_: "Slaughter"
Date: Fri, 04 Dec 2020 10:54:31 +0100
In-Reply-To: <F14250C1-2503-4022-9D9B-911D9EC0F5BA@HIDDEN>
(glyph@HIDDEN's message of "Thu, 3 Dec 2020 10:48:50
-0800")
Message-ID: <87lfednbfs.fsf@HIDDEN>
User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/28.0.50 (gnu/linux)
MIME-Version: 1.0
Content-Type: text/plain
X-Spam-Report: Spam detection software, running on the system "quimby.gnus.org",
has NOT identified this incoming email as spam. The original
message has been attached to this so you can view it or label
similar future email. If you have any questions, see
@@CONTACT_ADDRESS@@ for details.
Content preview: Glyph <glyph@HIDDEN> writes: > I don't know how
to force semantic to fully reparse a file, I just > observe its behavior
in response to idle times. A complete recipe, starting from "emacs -Q", would
be helpful.
Content analysis details: (-2.9 points, 5.0 required)
pts rule name description
---- ---------------------- --------------------------------------------------
-1.0 ALL_TRUSTED Passed through trusted hosts only via SMTP
-1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1%
[score: 0.0000]
X-Spam-Score: 0.0 (/)
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -1.0 (-)
Glyph <glyph@HIDDEN> writes:
> I don't know how to force semantic to fully reparse a file, I just
> observe its behavior in response to idle times.
A complete recipe, starting from "emacs -Q", would be helpful.
--
(domestic pets only, the antidote for overdose, milk.)
bloggy blog: http://lars.ingebrigtsen.no
Received: (at control) by debbugs.gnu.org; 19 Jan 2021 17:52:50 +0000 From debbugs-submit-bounces <at> debbugs.gnu.org Tue Jan 19 12:52:50 2021 Received: from localhost ([127.0.0.1]:51516 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1l1vBS-0002HV-DO for submit <at> debbugs.gnu.org; Tue, 19 Jan 2021 12:52:50 -0500 Received: from quimby.gnus.org ([95.216.78.240]:33996) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <larsi@HIDDEN>) id 1l1vBQ-0002HG-ED for control <at> debbugs.gnu.org; Tue, 19 Jan 2021 12:52:48 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnus.org; s=20200322; h=Subject:From:To:Message-Id:Date:Sender:Reply-To:Cc: MIME-Version:Content-Type:Content-Transfer-Encoding:Content-ID: Content-Description:Resent-Date:Resent-From:Resent-Sender:Resent-To:Resent-Cc :Resent-Message-ID:In-Reply-To:References:List-Id:List-Help:List-Unsubscribe: List-Subscribe:List-Post:List-Owner:List-Archive; bh=ptmpsX5FhGEGvitUnKTkSt9pVVmCLJ9XO4BScwyq0So=; b=UXJ1XqFPKoCY1sV2l/5OKDki6Z LK3gD2whBGz9c2WP+InHc3zsQWan4ipf0f2Bqh/TL9rjOTV2lAyi1p+hHDg2o89kz6mlnf6VjznYk WrxmIUIUoWtYPQ8WRzwGuTYfMI3AJ7dhzX9y8IlevxbcmsMdRAOg0itjC7l3i01+qQ7E=; Received: from cm-84.212.202.86.getinternet.no ([84.212.202.86] helo=xo) by quimby.gnus.org with esmtpsa (TLS1.3:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.92) (envelope-from <larsi@HIDDEN>) id 1l1vBI-0002kR-Ej for control <at> debbugs.gnu.org; Tue, 19 Jan 2021 18:52:42 +0100 Date: Tue, 19 Jan 2021 18:52:39 +0100 Message-Id: <87o8hkhl08.fsf@HIDDEN> To: control <at> debbugs.gnu.org From: Lars Ingebrigtsen <larsi@HIDDEN> Subject: control message for bug #21840 X-Spam-Report: Spam detection software, running on the system "quimby.gnus.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: tags 21840 - moreinfo quit Content analysis details: (-2.9 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -1.0 ALL_TRUSTED Passed through trusted hosts only via SMTP -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% [score: 0.0000] X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: control X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) tags 21840 - moreinfo quit
GNU bug tracking system
Copyright (C) 1999 Darren O. Benham,
1997 nCipher Corporation Ltd,
1994-97 Ian Jackson.