GNU bug report logs - #37492
GUIXSD 1.0.1 install error

Please note: This is a static page, with minimal formatting, updated once a day.
Click here to see this page with the latest information and nicer formatting.

Package: guix; Reported by: RAUL H C LOPES <rlopes@HIDDEN>; dated Mon, 23 Sep 2019 17:44:02 UTC; Maintainer for guix is bug-guix@HIDDEN.

Message received at 37492 <at> debbugs.gnu.org:


Received: (at 37492) by debbugs.gnu.org; 29 Sep 2019 12:00:26 +0000
From debbugs-submit-bounces <at> debbugs.gnu.org Sun Sep 29 08:00:26 2019
Received: from localhost ([127.0.0.1]:52464 helo=debbugs.gnu.org)
	by debbugs.gnu.org with esmtp (Exim 4.84_2)
	(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
	id 1iEXsI-0002Xf-8y
	for submit <at> debbugs.gnu.org; Sun, 29 Sep 2019 08:00:26 -0400
Received: from out1-smtp.messagingengine.com ([66.111.4.25]:48331)
 by debbugs.gnu.org with esmtp (Exim 4.84_2)
 (envelope-from <mbakke@HIDDEN>) id 1iEXsE-0002XR-JA
 for 37492 <at> debbugs.gnu.org; Sun, 29 Sep 2019 08:00:24 -0400
Received: from compute5.internal (compute5.nyi.internal [10.202.2.45])
 by mailout.nyi.internal (Postfix) with ESMTP id 47B3C21B6A;
 Sun, 29 Sep 2019 08:00:17 -0400 (EDT)
Received: from mailfrontend2 ([10.202.2.163])
 by compute5.internal (MEProxy); Sun, 29 Sep 2019 08:00:17 -0400
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h=
 from:to:subject:in-reply-to:references:date:message-id
 :mime-version:content-type; s=fm1; bh=VLKPH73YBnpjQB+l8dhR4lNnLT
 iSVyUc94Annl8wI50=; b=U/fjZsX3ibMHC3Q1y6NhAxgxe+whS3D+dQ1siGVsOy
 qZCt+xkIPwpa1nIdD+p9r4kZdxEenqiHkbrbmY/pltsTkfLjYNfeRJY/gGvtzLbw
 kjdpEDsQkTZ990/6tqPNG1ATCS2zgvjieeL114gdd19GC00UVoDzrmeZMURK1few
 rmClhYy4GhLLJ2h0qP/to7pv79E6dvyJP5DKnIMiDwoXhLId5dEa4I2kBuZORrFN
 A0qgUCO+pzyvMR9uMkwAmRf4qrtu4xuCxLkItJSLHgLRhjzMvxgsPqCz6d3hbszJ
 a81WHHvM0TOIVaAipBmSubcMfvcPRUsiHix1A4pYPBvA==
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=
 messagingengine.com; h=content-type:date:from:in-reply-to
 :message-id:mime-version:references:subject:to:x-me-proxy
 :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=VLKPH7
 3YBnpjQB+l8dhR4lNnLTiSVyUc94Annl8wI50=; b=bLISwsf2xWK2HC+9HD8ow+
 FjbZEYaw2i8UwhEPB8NkO1CM0Ri/YJTCQhmJmcRzowflpfM1fbwcRJYLRGuj018h
 h+HL3hhHtdQK0oJMYdHGrq7lRolaKszvm4GInWwlMYfpjhiBt86lWtff2MdR93Gi
 0GWT6V6Jnpvo7nDPWJdWv+a05FJ/vKlm7t45Fg0C9SFMoakvyTjY7BGXLsATwdMw
 ND58/eqW2YjTCe6Bb7ioCCKEGPnouoGhHYCjx8RTtXMieqECCsMspCdjvljVxme1
 LEHvGq73yiCqnDkHKHjx4CKVeQsF6+ivwwxonCH5zeln9+2Wj6NDGW0EakyTAGKQ
 ==
X-ME-Sender: <xms:0ZyQXbpqbZ_LXZOWHnxsSYEGP4UOvTO4z2n9cGrwl1R-ICjkUuXiIQ>
X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedufedrgedtgdegkecutefuodetggdotefrodftvf
 curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu
 uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc
 fjughrpefhvffujghffgffkfggtgesghdtreertderjeenucfhrhhomhepofgrrhhiuhhs
 uceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecuffhomhgrih
 hnpehgnhhurdhorhhgnecukfhppeeivddrudeirdduledvrdduhedtnecurfgrrhgrmhep
 mhgrihhlfhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmnecuvehluhhsth
 gvrhfuihiivgeptd
X-ME-Proxy: <xmx:0ZyQXUJ4VqjMYgp6FrvDqGQo4dzysXinSZM52SCorUYOX9SwG3j-fA>
 <xmx:0ZyQXegEK2qaH661ECXKoItfu8dbEJe9Ml5_jXP0PWBZ6I7tetu6kw>
 <xmx:0ZyQXVfCGtaLsb2VN-mR4vgLDIZDW-OFxfNMzeXt0AcXM5Ys2XUZNA>
 <xmx:0ZyQXTFkq74gA99wv9506J5dZrWrQud6gqThWo-eL0yOqJFrv6VLqA>
Received: from localhost (ti0006q161-0149.bb.online.no [62.16.192.150])
 by mail.messagingengine.com (Postfix) with ESMTPA id AD1BCD6005A;
 Sun, 29 Sep 2019 08:00:16 -0400 (EDT)
From: Marius Bakke <mbakke@HIDDEN>
To: RAUL H C LOPES <rlopes@HIDDEN>, 37492 <at> debbugs.gnu.org
Subject: Re: bug#37492: GUIXSD 1.0.1 install error
In-Reply-To: <bb5ec33e-692a-c03c-7cad-80e63a492acc@HIDDEN>
References: <4b7c7353-c7b0-8ced-c71d-0d4396096c74@HIDDEN>
 <4d9c1047-b32c-1603-ca32-da57c3326e21@HIDDEN> <874l0xa1mx.fsf@HIDDEN>
 <bb5ec33e-692a-c03c-7cad-80e63a492acc@HIDDEN>
User-Agent: Notmuch/0.29.1 (https://notmuchmail.org) Emacs/26.2
 (x86_64-pc-linux-gnu)
Date: Sun, 29 Sep 2019 14:00:15 +0200
Message-ID: <87v9tb8g8g.fsf@HIDDEN>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-=";
 micalg=pgp-sha512; protocol="application/pgp-signature"
X-Spam-Score: -0.7 (/)
X-Debbugs-Envelope-To: 37492
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, 
 <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, 
 <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -1.7 (-)

--=-=-=
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

RAUL H C LOPES <rlopes@HIDDEN> writes:

> Hi Marius,
>
> I've managed to install GuixSD by chossing=C2=A0 msdos instead of gpt.=20
> Coincidence? Is the gpt setup tested?

Can you share the steps required to reproduce the error?

> I've running the system for a few days.
>
> I need now a good manual> I'm suffering for:
>  =C2=A0- reconfigure stuff that is usually in /etc, like /etc/ssh/sshd_co=
nfig;

There is a good up-to-date manual here:
<https://guix.gnu.org/manual/devel>.  Search for 'openssh-configuration'
for examples on how to configure the SSH daemon.

>  =C2=A0- running a make on an open source project who looks for linux lib=
s=20
> where debian would find them.

Typically you would do something like `guix environment --ad-hoc
gcc-toolchain make` to enter a shell environment where all the
dependencies of the program you want to build are present.

--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl2QnM8ACgkQoqBt8qM6
VPqwYQf/ZkRrLLQnIKkgTRHrTnQRog6w55rCCn0a+TGlvrf5qpxT3EROpNWvHiIT
SBwBhrRtU1mAOHgKy3fTZlzKOGBrRkLm5z9kqJPVAc6e43yqDZYGlPr+gl/qIcYl
1geng4ZWLvtbcl7bPHU+TTuPcJhGf5a39T/vbRHvttzIMVCjOwqzekAPaAroLYU7
VtmmMqaFtL7qpwLtqaz7MwJ2HkmZ3myW67qq4UnmOdlYdE51LcZ7MzoMkt87gi3o
drdUS1vFM5/IJpCbTd9drfJe3cj/jMEtBHOu2GvzD4cM0DbUOo7nYrdnqdKTqu9m
0B4DaOP+oXeosj0jMZA0cB0+vZgdnA==
=P/N+
-----END PGP SIGNATURE-----
--=-=-=--




Information forwarded to bug-guix@HIDDEN:
bug#37492; Package guix. Full text available.

Message received at 37492 <at> debbugs.gnu.org:


Received: (at 37492) by debbugs.gnu.org; 27 Sep 2019 23:58:25 +0000
From debbugs-submit-bounces <at> debbugs.gnu.org Fri Sep 27 19:58:25 2019
Received: from localhost ([127.0.0.1]:48834 helo=debbugs.gnu.org)
	by debbugs.gnu.org with esmtp (Exim 4.84_2)
	(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
	id 1iE07z-0000sR-Og
	for submit <at> debbugs.gnu.org; Fri, 27 Sep 2019 19:58:25 -0400
Received: from mail-eopbgr70051.outbound.protection.outlook.com
 ([40.107.7.51]:38275 helo=EUR04-HE1-obe.outbound.protection.outlook.com)
 by debbugs.gnu.org with esmtp (Exim 4.84_2)
 (envelope-from <raul.cardoso.lopes@HIDDEN>) id 1iDz4b-0007Br-Jd
 for 37492 <at> debbugs.gnu.org; Fri, 27 Sep 2019 18:50:50 -0400
ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none;
 b=EMBnPLd63JsybWwPUP/ychqhmTQWX/Nm1vtMOgxx1gxq1s6lb6GgGCHpELNlJmn8WFE/rokChZ7MwXoS0SAXL3aap8HqfXZ9rQdw+HUL0hfxKNu1Xt0VQSNiGf77vfa9bZFyrA6cDwgP94xEwNAv82vVdf3BGYYQn/1BbZT5eZG9mZTMn7beGXVfUautS8fmD5M/QQvRxcruxhrCvmUsZJx2FkkkGlqypFVzWpzst/tmPC+p382k0iFBKma3Tlc2ai2Ck/LXUyeJts08FJBdRm7Tl2Zudyn18+6F1s3Wgoe2HXyLATfSIdCX2uxCemCcTgJS5UabgeCgVNGwH9fQiA==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; 
 s=arcselector9901;
 h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck;
 bh=2jywsiRR5IWOISAAeFRFJB8jUeidkgmhn37Y438vEmo=;
 b=a4sMj31aChStdIBLb0G3Qf7EBcKyyHVwbZqG8+dEIKVSGRnGi5x+YcnWP/jJvcCjAmWhDuh1IBielyLPUSfPvUC+270eKNdclFIC2H9fATJl8SCT7dGC+RJ1TsqD8GEf/HkSL9Um7V2Ml8GoYQbekZ+yG+fSHk/0U1CMQWOJkAR6L5n7sFBSKa6sz6tPIEagI3s1jgXqKOX8zxuLoROjfYJzKAJhWLzv1E5rbIaPKRXMTiE6CYMa4f/SaEtrwVkyEWBjvSBw1XWaPlM2wcCndDk2WKkJkn+cm4of2ZIBoayROQBQeS6aicPiDXHk+AgaZor+g3fc+lck2vM1lqcwvA==
ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass (sender ip is
 188.184.36.46) smtp.rcpttodomain=debbugs.gnu.org smtp.mailfrom=cern.ch;
 dmarc=bestguesspass action=none header.from=cern.ch; dkim=none (message not
 signed); arc=none
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=cern.onmicrosoft.com; 
 s=selector2-cern-onmicrosoft-com;
 h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck;
 bh=2jywsiRR5IWOISAAeFRFJB8jUeidkgmhn37Y438vEmo=;
 b=lwZauNk1cMMOxqo7Pg5LIC8BLFMXlUAqTDdn4Td5Vdj6LOyoZTKH2Gt/Mqj6gJYFO5dKyDy4VcqJ8yEn69riM+Ks0mppHXJDJkAphzQPIUszaIPZTK6xpBje3GpEd4khzJzUKl+jE/3zyR84vruJxuGVVy4oNfW8AxKTsqwvkqE=
Received: from AM5PR0601CA0030.eurprd06.prod.outlook.com
 (2603:10a6:203:68::16) by AM0PR06MB6034.eurprd06.prod.outlook.com
 (2603:10a6:208:118::21) with Microsoft SMTP Server (version=TLS1_2,
 cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.2284.20; Fri, 27 Sep
 2019 22:50:42 +0000
Received: from VE1EUR02FT030.eop-EUR02.prod.protection.outlook.com
 (2a01:111:f400:7e06::202) by AM5PR0601CA0030.outlook.office365.com
 (2603:10a6:203:68::16) with Microsoft SMTP Server (version=TLS1_2,
 cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.2305.20 via Frontend
 Transport; Fri, 27 Sep 2019 22:50:42 +0000
Authentication-Results: spf=pass (sender IP is 188.184.36.46)
 smtp.mailfrom=cern.ch; debbugs.gnu.org; dkim=none (message not signed)
 header.d=none;debbugs.gnu.org; dmarc=bestguesspass action=none
 header.from=cern.ch;
Received-SPF: Pass (protection.outlook.com: domain of cern.ch designates
 188.184.36.46 as permitted sender) receiver=protection.outlook.com;
 client-ip=188.184.36.46; helo=cernmxgwlb4.cern.ch;
Received: from cernmxgwlb4.cern.ch (188.184.36.46) by
 VE1EUR02FT030.mail.protection.outlook.com (10.152.12.127) with Microsoft SMTP
 Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id
 15.20.2305.15 via Frontend Transport; Fri, 27 Sep 2019 22:50:41 +0000
Received: from cernfe02.cern.ch (188.184.36.47) by cernmxgwlb4.cern.ch
 (188.184.36.46) with Microsoft SMTP Server (TLS) id 14.3.439.0; Sat, 28 Sep
 2019 00:50:39 +0200
Received: from [192.168.178.25] (88.98.86.77) by smtp.cern.ch (188.184.36.52)
 with Microsoft SMTP Server (TLS) id 14.3.468.0;
 Sat, 28 Sep 2019 00:50:42 +0200
Subject: Re: bug#37492: GUIXSD 1.0.1 install error
To: Marius Bakke <mbakke@HIDDEN>, <37492 <at> debbugs.gnu.org>
References: <4b7c7353-c7b0-8ced-c71d-0d4396096c74@HIDDEN>
 <4d9c1047-b32c-1603-ca32-da57c3326e21@HIDDEN> <874l0xa1mx.fsf@HIDDEN>
From: RAUL H C LOPES <rlopes@HIDDEN>
Message-ID: <bb5ec33e-692a-c03c-7cad-80e63a492acc@HIDDEN>
Date: Fri, 27 Sep 2019 23:50:40 +0100
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:60.0) Gecko/20100101
 Thunderbird/60.8.0
MIME-Version: 1.0
In-Reply-To: <874l0xa1mx.fsf@HIDDEN>
Content-Type: text/plain; charset="utf-8"; format=flowed
Content-Transfer-Encoding: 8bit
Content-Language: en-US
X-Originating-IP: [88.98.86.77]
X-EOPAttributedMessage: 0
X-Forefront-Antispam-Report: CIP:188.184.36.46; IPV:NLI; CTRY:CH; EFV:NLI;
 SFV:NSPM;
 SFS:(10009020)(136003)(39860400002)(346002)(376002)(396003)(189003)(199004)(26005)(316002)(65806001)(65956001)(66066001)(7736002)(31696002)(446003)(2870700001)(186003)(31686004)(478600001)(426003)(476003)(956004)(305945005)(336012)(486006)(2616005)(23676004)(11346002)(16526019)(47776003)(126002)(229853002)(6246003)(2486003)(356004)(58126008)(106002)(110136005)(8936002)(50466002)(36756003)(53546011)(76176011)(246002)(70206006)(7636002)(8676002)(3846002)(6116002)(2906002)(14444005)(70586007)(16576012)(5660300002);
 DIR:OUT; SFP:1101; SCL:1; SRVR:AM0PR06MB6034; H:cernmxgwlb4.cern.ch; FPR:;
 SPF:Pass; LANG:en; PTR:cernmx13.cern.ch; MX:1; A:1; 
X-MS-PublicTrafficType: Email
X-MS-Office365-Filtering-Correlation-Id: 958f751a-1925-47a3-2a93-08d7439d1ffa
X-Microsoft-Antispam: BCL:0; PCL:0;
 RULEID:(2390118)(7020095)(4652040)(8989299)(5600167)(711020)(4605104)(4709080)(1401327)(4534185)(4627221)(201703031133081)(201702281549075)(8990200)(2017052603328)(7193020);
 SRVR:AM0PR06MB6034; 
X-MS-TrafficTypeDiagnostic: AM0PR06MB6034:
X-Microsoft-Antispam-PRVS: <AM0PR06MB603478E759AAB2ABAC9AE67CCD810@HIDDEN>
X-MS-Oob-TLC-OOBClassifiers: OLM:7691;
X-Forefront-PRVS: 0173C6D4D5
X-MS-Exchange-SenderADCheck: 1
X-Microsoft-Antispam-Message-Info: Nx/pO5yf3+/mFkmrAfnvSeaYhRa8iGEXGstdNCMIwqrXho5X6srdt8+qI7lKLckG0DMBb1KzVf+v7J+aTa7S2IoxzvTrHcOZA2GPLdW3xfxYRHo099zKIRIzzoTe0DoP6jV9KCbXPYQVrOjn+RcRycFY781MNzULmmY7Uab+rvMvUx62BBF2I2Pa1hdtu6CfD01BN0PHIAX5Sv+BjrKJb8LHqFdPXl6+kojKlV4jdWJfSEXdYIinXvoef7+agJyoySTAT/cYqafpkTSd5kerYUIC+WMZZm1FoEsWTBoty89p4KTDmT/P1ZnhtPwGR04j5bmewix+Z3IfcgfPDLPyNTLP1VPvKHu2JQyDmjTd0asH5Zidj7JTHUfC16eiRIJXOOUTTDQvX2ydPdswoVImfbjuEBhL/0eHo7aJcgl3m+I=
X-OriginatorOrg: cern.ch
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 27 Sep 2019 22:50:41.8987 (UTC)
X-MS-Exchange-CrossTenant-Network-Message-Id: 958f751a-1925-47a3-2a93-08d7439d1ffa
X-MS-Exchange-CrossTenant-Id: c80d3499-4a40-4a8c-986e-abce017d6b19
X-MS-Exchange-CrossTenant-OriginalAttributedTenantConnectingIp: TenantId=c80d3499-4a40-4a8c-986e-abce017d6b19; Ip=[188.184.36.46];
 Helo=[cernmxgwlb4.cern.ch]
X-MS-Exchange-CrossTenant-FromEntityHeader: HybridOnPrem
X-MS-Exchange-Transport-CrossTenantHeadersStamped: AM0PR06MB6034
X-Spam-Score: -0.0 (/)
X-Debbugs-Envelope-To: 37492
X-Mailman-Approved-At: Fri, 27 Sep 2019 19:58:22 -0400
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, 
 <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, 
 <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -1.0 (-)

Hi Marius,

I've managed to install GuixSD by chossing  msdos instead of gpt. 
Coincidence? Is the gpt setup tested?

I've running the system for a few days.

I need now a good manual> I'm suffering for:
  - reconfigure stuff that is usually in /etc, like /etc/ssh/sshd_config;
  - running a make on an open source project who looks for linux libs 
where debian would find them.

Regards, Raul

On 27/09/2019 22:08, Marius Bakke wrote:
> Hello Raul,
>
> RAUL H C LOPES <rlopes@HIDDEN> writes:
>
>> Hi,
>>
>>
>> I've emailed a few hours ago about an error in the GUIXSD installer. It
>> might be relevant that I was doing encrypted home and root. Very likely
>> unconnected.
>>
>>
>> I've just tried a new install without encryption. A new failure:
>>
>>     .../grub-install- error: efibootmgr failed to register the boot
>> entry: Input/output error.
> This means that GRUB failed to update the UEFI variables on your system.
> Are you using the generated configuration file or a custom one?
>
> The most likely reason for this error is that you are using
> 'grub-efi-bootloader' on a non-EFI system.  Changing to
> 'grub-bootloader' should solve it in that case.
>
> HTH,
> Marius






Information forwarded to bug-guix@HIDDEN:
bug#37492; Package guix. Full text available.

Message received at 37492 <at> debbugs.gnu.org:


Received: (at 37492) by debbugs.gnu.org; 27 Sep 2019 21:08:17 +0000
From debbugs-submit-bounces <at> debbugs.gnu.org Fri Sep 27 17:08:17 2019
Received: from localhost ([127.0.0.1]:48762 helo=debbugs.gnu.org)
	by debbugs.gnu.org with esmtp (Exim 4.84_2)
	(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
	id 1iDxTM-0003sl-OU
	for submit <at> debbugs.gnu.org; Fri, 27 Sep 2019 17:08:17 -0400
Received: from out3-smtp.messagingengine.com ([66.111.4.27]:43965)
 by debbugs.gnu.org with esmtp (Exim 4.84_2)
 (envelope-from <mbakke@HIDDEN>) id 1iDxTK-0003sP-Tj
 for 37492 <at> debbugs.gnu.org; Fri, 27 Sep 2019 17:08:15 -0400
Received: from compute5.internal (compute5.nyi.internal [10.202.2.45])
 by mailout.nyi.internal (Postfix) with ESMTP id 904AA2222B;
 Fri, 27 Sep 2019 17:08:09 -0400 (EDT)
Received: from mailfrontend1 ([10.202.2.162])
 by compute5.internal (MEProxy); Fri, 27 Sep 2019 17:08:09 -0400
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h=
 from:to:subject:in-reply-to:references:date:message-id
 :mime-version:content-type; s=fm1; bh=yPOpNuW1+sdFsajNVaSMsI17x3
 jUUJQOb8qXm8mnRuc=; b=Lcrasy0vsrtaHv/6Yz6ZdDM3VeEcNpEH55gRYEe4ld
 Qr0PXx7WIGtN2OD3Alp0eDmmz01yWWzfVzy26eQ7gmLjzWe1U8X0AR5ug8oI3PfN
 2RppVksBK9MU/cHUV+uRKNaO/lL/70XNnxyFmdsPQdO9j5QkfsanOtnw+uG+c1yw
 t2MBcwMabqNzuyBvzUVtfTktJe9SrAPVYIrsDSrlWE6Yc8jbOm4+yv9AtQYizA2a
 0bRVh03r/E+77V8Ykiq+piBmTBTMLPbD3z7GggxoYjW2Y/8m9Vp+yaAyDyDaSl/x
 odyBZBrNIvecXLUffTj8uWLr8l5JJeOkzxS/HSb/0ikQ==
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=
 messagingengine.com; h=content-type:date:from:in-reply-to
 :message-id:mime-version:references:subject:to:x-me-proxy
 :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=yPOpNu
 W1+sdFsajNVaSMsI17x3jUUJQOb8qXm8mnRuc=; b=tGOAQBrCdOksSnU+uP0oIw
 Cg1W523MQmv3pxAbZZvdU1h1bJTwZDprAdiY4pOEUf+VPWLTnoJckxF40J6sWKe0
 ZC0aL34q+uBCUPGBfyIqs+9uhXJJevoXMizws+6vNgUFWsIkE3JrRUr4LeIejy7Y
 A6SqWNHCCzJpQjMpSoKq4LCruESEZGytBMelqeiI46yruLV1ekwhSWnulyfHNNHm
 q6ez+urn0xvxsz5Z8TyuxnnPctwtmKlVPy7flSM/HAq2R9c/NXQVdkDh9dmH/tvj
 ne+wBkiRymCPUWQPYwtOAwy9Sy4qAVthFjIAuu4Naqj0L7TZMN86APuAvI1E6TVw
 ==
X-ME-Sender: <xms:OHqOXdTI_x8yS68NGPTlcLRLeGA-1r9X1xqLDvkMZhOPZvzS4OWlgQ>
X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedufedrfeeigdduheegucetufdoteggodetrfdotf
 fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen
 uceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmne
 cujfgurhephffvufgjfhgffffkgggtsehgtderredtreejnecuhfhrohhmpeforghrihhu
 shcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeenucfkphepie
 dvrdduiedrudelvddrudehtdenucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgv
 sehfrghsthhmrghilhdrtghomhenucevlhhushhtvghrufhiiigvpedt
X-ME-Proxy: <xmx:OHqOXQcIGWAtJ4g-u5qxbUG7uz34M56sxVSGoKyCOPfJpzBVE2tHqA>
 <xmx:OHqOXZyUy5tSuWwRHYUlIFRZplSxnSUk0eV9G8phBKWlzPwR_pq3oQ>
 <xmx:OHqOXZGLOilpLtsIdIE6AzQRjhBMwShCD5AedrIQr9A5kXWUz5C5FA>
 <xmx:OXqOXe7Ww0I_rqrGHsraoVdIX7XXgTyqq0CGXS0QQRyHUwiqvDVX4w>
Received: from localhost (ti0006q161-0149.bb.online.no [62.16.192.150])
 by mail.messagingengine.com (Postfix) with ESMTPA id 8104180061;
 Fri, 27 Sep 2019 17:08:08 -0400 (EDT)
From: Marius Bakke <mbakke@HIDDEN>
To: RAUL H C LOPES <rlopes@HIDDEN>, 37492 <at> debbugs.gnu.org
Subject: Re: bug#37492: GUIXSD 1.0.1 install error
In-Reply-To: <4d9c1047-b32c-1603-ca32-da57c3326e21@HIDDEN>
References: <4b7c7353-c7b0-8ced-c71d-0d4396096c74@HIDDEN>
 <4d9c1047-b32c-1603-ca32-da57c3326e21@HIDDEN>
User-Agent: Notmuch/0.29.1 (https://notmuchmail.org) Emacs/26.2
 (x86_64-pc-linux-gnu)
Date: Fri, 27 Sep 2019 23:08:06 +0200
Message-ID: <874l0xa1mx.fsf@HIDDEN>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-=";
 micalg=pgp-sha512; protocol="application/pgp-signature"
X-Spam-Score: -0.7 (/)
X-Debbugs-Envelope-To: 37492
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, 
 <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, 
 <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -1.7 (-)

--=-=-=
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Hello Raul,

RAUL H C LOPES <rlopes@HIDDEN> writes:

> Hi,
>
>
> I've emailed a few hours ago about an error in the GUIXSD installer. It=20
> might be relevant that I was doing encrypted home and root. Very likely=20
> unconnected.
>
>
> I've just tried a new install without encryption. A new failure:
>
>  =C2=A0 .../grub-install- error: efibootmgr failed to register the boot=20
> entry: Input/output error.

This means that GRUB failed to update the UEFI variables on your system.
Are you using the generated configuration file or a custom one?

The most likely reason for this error is that you are using
'grub-efi-bootloader' on a non-EFI system.  Changing to
'grub-bootloader' should solve it in that case.

HTH,
Marius

--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl2OejYACgkQoqBt8qM6
VPpV9gf/UwCID30X8al5II1poa+nTK8hIE7MPSQue4LD5PLnwWe5UGCWI6t8KCGL
AYpCEmTgkDLWLG4qkIrekv85vGRKU/N5069khRtIOppuQa2zrr2y4nIwLMEABaRM
/xGsMzZC3z+ENq9l/kiVq5/qFGZ0Bp4ahoQfDpB2I3o2zmDF1BB7RYLmYNj8zZ+o
GvZ2ovYy9o2szQe9kIgVCjuysjHs1Y3pmt1rthNLBNU2+t7Z/6nDv6EFTRMrmmjp
IiL4ydZjyIuNHWB4DjDhoBSoV3IUEFiDg7CBfOA7jU2gB3BvsL568O3vDgYazI4y
4kUzLYJ28CyGFkwgbI76fZFU5hEEYg==
=HI34
-----END PGP SIGNATURE-----
--=-=-=--




Information forwarded to bug-guix@HIDDEN:
bug#37492; Package guix. Full text available.

Message received at 37492 <at> debbugs.gnu.org:


Received: (at 37492) by debbugs.gnu.org; 23 Sep 2019 23:33:27 +0000
From debbugs-submit-bounces <at> debbugs.gnu.org Mon Sep 23 19:33:27 2019
Received: from localhost ([127.0.0.1]:37304 helo=debbugs.gnu.org)
	by debbugs.gnu.org with esmtp (Exim 4.84_2)
	(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
	id 1iCXpe-0007Ym-Mo
	for submit <at> debbugs.gnu.org; Mon, 23 Sep 2019 19:33:27 -0400
Received: from mail-eopbgr40044.outbound.protection.outlook.com
 ([40.107.4.44]:11140 helo=EUR03-DB5-obe.outbound.protection.outlook.com)
 by debbugs.gnu.org with esmtp (Exim 4.84_2)
 (envelope-from <raul.cardoso.lopes@HIDDEN>) id 1iCWFq-000588-Q3
 for 37492 <at> debbugs.gnu.org; Mon, 23 Sep 2019 17:52:23 -0400
ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none;
 b=Z4/SQt3ALISZ70VEJ19CYs4kHixBuEMuqEGM/rSOdIhvI7uUBRY+DjOu1E1iKBc3jxhvRuZtpFrP4xIA9CWcfC7f6AQVvqTtM3zZykVF0f1B5gId9JQTE/5d8Ge762i1fJGJYyMEulCKzirDq/zA1R9dmRvAdt2+6HpEgupST/WldBs1L673ZDnrKDGgkbbedjVBoeGGylYkz4ruNv5umoR8cU/6cH21Z98Cdu0/7sWiXVIe0PVxq93n80YUziC9ZmRU9DLgcJAkfm89SrkBGXv+HEGSmEsA2eSE9j/3ggU8VXaiBN5KucYnJ+exGZcc2gfgVtFQ12caSutPer9L2Q==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; 
 s=arcselector9901;
 h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck;
 bh=2Q7pzHAfpirKvkoU6BWB7NWOYXXHMPvx/+bKJAlFOZE=;
 b=L5g2pMTMmQ3BdPS/cYniYLjhW+z4+vhMdZNEM6MpHDOaLPbRuoZXFUnNhYxgN+PHVxc6Yg8b9l34dyrF+Oa9OQx5kMkY6vskYBsj9Dk2iE/LvY1rmYjJShPGhu9T2j9l6dKM8cY/jr1mVJ/962xuUMYX2hE6jS/oPYKlvixtvvLbVJcKBMPRGh5dEkwi2r6JIwebd9MsS8s9MzyrOud1JYc4S/yi5SRQF7n07piQ8IxiIGhcJoLBSMsgJApk0QP7//+5ozQPqBHnp0UA+XKC0K97xb5VhKMos0c2fsyo/tmanckmJkBMIYEXd8JUKXmg/OqnRsXLOPQGjA0GcAWZdQ==
ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass (sender ip is
 188.184.36.48) smtp.rcpttodomain=debbugs.gnu.org smtp.mailfrom=cern.ch;
 dmarc=bestguesspass action=none header.from=cern.ch; dkim=none (message not
 signed); arc=none
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=cern.onmicrosoft.com; 
 s=selector2-cern-onmicrosoft-com;
 h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck;
 bh=2Q7pzHAfpirKvkoU6BWB7NWOYXXHMPvx/+bKJAlFOZE=;
 b=EqyeAWQXt7FDq71IJ0MLn19RlLb7DUoU94EUYCUYhbDpctCZ0uThGxljBkM3EJ17r/lz7B+t8IKD5Hg8uTULaQ2tqj54uZNNQ23vMsCzpePFicT8YXewAP9H9F/KHmcS4HY7/ajuNvkTApTrmcvOpw2eFE526nViMibLsYoRee4=
Received: from HE1PR06CA0160.eurprd06.prod.outlook.com (2603:10a6:7:16::47) by
 AM6PR06MB5525.eurprd06.prod.outlook.com (2603:10a6:20b:9e::17) with
 Microsoft
 SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id
 15.20.2284.20; Mon, 23 Sep 2019 21:52:15 +0000
Received: from VE1EUR02FT028.eop-EUR02.prod.protection.outlook.com
 (2a01:111:f400:7e06::209) by HE1PR06CA0160.outlook.office365.com
 (2603:10a6:7:16::47) with Microsoft SMTP Server (version=TLS1_2,
 cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.2284.20 via Frontend
 Transport; Mon, 23 Sep 2019 21:52:15 +0000
Authentication-Results: spf=pass (sender IP is 188.184.36.48)
 smtp.mailfrom=cern.ch; debbugs.gnu.org; dkim=none (message not signed)
 header.d=none;debbugs.gnu.org; dmarc=bestguesspass action=none
 header.from=cern.ch;
Received-SPF: Pass (protection.outlook.com: domain of cern.ch designates
 188.184.36.48 as permitted sender) receiver=protection.outlook.com;
 client-ip=188.184.36.48; helo=cernmxgwlb4.cern.ch;
Received: from cernmxgwlb4.cern.ch (188.184.36.48) by
 VE1EUR02FT028.mail.protection.outlook.com (10.152.12.81) with Microsoft SMTP
 Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id
 15.20.2284.20 via Frontend Transport; Mon, 23 Sep 2019 21:52:15 +0000
Received: from cernfe02.cern.ch (188.184.36.47) by cernmxgwlb4.cern.ch
 (188.184.36.48) with Microsoft SMTP Server (TLS) id 14.3.439.0; Mon, 23 Sep
 2019 23:52:15 +0200
Received: from [192.168.178.25] (88.98.86.77) by smtp.cern.ch (188.184.36.52)
 with Microsoft SMTP Server (TLS) id 14.3.468.0;
 Mon, 23 Sep 2019 23:52:13 +0200
To: <37492 <at> debbugs.gnu.org>
From: RAUL H C LOPES <rlopes@HIDDEN>
Subject: GUIXSD 1.0.1 install error
Message-ID: <4d9c1047-b32c-1603-ca32-da57c3326e21@HIDDEN>
Date: Mon, 23 Sep 2019 22:52:13 +0100
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:60.0) Gecko/20100101
 Thunderbird/60.8.0
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"; format=flowed
Content-Transfer-Encoding: 8bit
Content-Language: en-US
X-Originating-IP: [88.98.86.77]
X-EOPAttributedMessage: 0
X-Forefront-Antispam-Report: CIP:188.184.36.48; IPV:NLI; CTRY:CH; EFV:NLI;
 SFV:NSPM;
 SFS:(10009020)(39860400002)(376002)(346002)(136003)(396003)(199004)(189003)(106002)(486006)(126002)(476003)(66066001)(426003)(2616005)(336012)(31686004)(8936002)(356004)(956004)(186003)(2351001)(26005)(16526019)(7116003)(6916009)(8676002)(65806001)(47776003)(50466002)(316002)(65956001)(6116002)(3846002)(2870700001)(4744005)(305945005)(2486003)(23676004)(36756003)(7636002)(2906002)(478600001)(7736002)(5660300002)(58126008)(70206006)(70586007)(31696002)(246002)(16576012)(14444005);
 DIR:OUT; SFP:1101; SCL:1; SRVR:AM6PR06MB5525; H:cernmxgwlb4.cern.ch; FPR:;
 SPF:Pass; LANG:en; PTR:cernmx12.cern.ch; A:1; MX:1; 
X-MS-PublicTrafficType: Email
X-MS-Office365-Filtering-Correlation-Id: 480270b7-4585-4a69-2505-08d740704c18
X-Microsoft-Antispam: BCL:0; PCL:0;
 RULEID:(2390118)(7020095)(4652040)(8989299)(4534185)(4627221)(201703031133081)(201702281549075)(8990200)(5600167)(711020)(4605104)(4709080)(1401327)(2017052603328)(7193020);
 SRVR:AM6PR06MB5525; 
X-MS-TrafficTypeDiagnostic: AM6PR06MB5525:
X-Microsoft-Antispam-PRVS: <AM6PR06MB55259A477D2FFEC2315EE198CD850@HIDDEN>
X-MS-Oob-TLC-OOBClassifiers: OLM:6430;
X-Forefront-PRVS: 0169092318
X-MS-Exchange-SenderADCheck: 1
X-Microsoft-Antispam-Message-Info: oycaTv5r+F56GXSRk7pWlHnu6cYKf91ylBrTj/ftQmhbBAypcpUshucIeA/hVKnfoMxakkLVgYIeC1Y+xKcVBTwN3LEjjd7lIZnlaB2/aMs9XQSHoEw7SlkUO1qeC4nm07RdBiUuDn5b3XaKXRe6lZJHiIocWS7xHgMqYZO794zf2mg+1fz8cdANQK7RzCfl23LV4CoJUG2fpPMDchYVuaYc+JC+DPcL/JoGuF99u4kAceTa0zUohptRXws44dxZy8nx71h6OJdyMuGLwvXCYScQ7KDPTJV0OHoNcFGsEHVyzJMJt/mP/nVD7MQTY98Hksm8VBl7QEUIhjT+ES5x8564nbMDtFNxpaPPK758NxRGQa8pxC17FDmeyi4+rIPFYixJQJswLuiPfzGh6w31x3VlA2ikiKfPZzyOWJX9Smo=
X-OriginatorOrg: cern.ch
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 23 Sep 2019 21:52:15.0067 (UTC)
X-MS-Exchange-CrossTenant-Network-Message-Id: 480270b7-4585-4a69-2505-08d740704c18
X-MS-Exchange-CrossTenant-Id: c80d3499-4a40-4a8c-986e-abce017d6b19
X-MS-Exchange-CrossTenant-OriginalAttributedTenantConnectingIp: TenantId=c80d3499-4a40-4a8c-986e-abce017d6b19; Ip=[188.184.36.48];
 Helo=[cernmxgwlb4.cern.ch]
X-MS-Exchange-CrossTenant-FromEntityHeader: HybridOnPrem
X-MS-Exchange-Transport-CrossTenantHeadersStamped: AM6PR06MB5525
X-Spam-Score: -0.0 (/)
X-Debbugs-Envelope-To: 37492
X-Mailman-Approved-At: Mon, 23 Sep 2019 19:33:25 -0400
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, 
 <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, 
 <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -1.0 (-)

Hi,


I've emailed a few hours ago about an error in the GUIXSD installer. It 
might be relevant that I was doing encrypted home and root. Very likely 
unconnected.


I've just tried a new install without encryption. A new failure:

   .../grub-install- error: efibootmgr failed to register the boot 
entry: Input/output error.


Regards,  Raul





Information forwarded to bug-guix@HIDDEN:
bug#37492; Package guix. Full text available.

Message received at submit <at> debbugs.gnu.org:


Received: (at submit) by debbugs.gnu.org; 23 Sep 2019 17:43:45 +0000
From debbugs-submit-bounces <at> debbugs.gnu.org Mon Sep 23 13:43:45 2019
Received: from localhost ([127.0.0.1]:37038 helo=debbugs.gnu.org)
	by debbugs.gnu.org with esmtp (Exim 4.84_2)
	(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
	id 1iCSNC-0004rB-2C
	for submit <at> debbugs.gnu.org; Mon, 23 Sep 2019 13:43:45 -0400
Received: from lists.gnu.org ([209.51.188.17]:56968)
 by debbugs.gnu.org with esmtp (Exim 4.84_2)
 (envelope-from <raul.cardoso.lopes@HIDDEN>) id 1iCS1r-0002CH-BW
 for submit <at> debbugs.gnu.org; Mon, 23 Sep 2019 13:21:39 -0400
Received: from eggs.gnu.org ([2001:470:142:3::10]:40916)
 by lists.gnu.org with esmtp (Exim 4.90_1)
 (envelope-from <raul.cardoso.lopes@HIDDEN>) id 1iCS1q-0007MJ-5i
 for bug-guix@HIDDEN; Mon, 23 Sep 2019 13:21:39 -0400
X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org
X-Spam-Level: ***
X-Spam-Status: No, score=3.3 required=5.0 tests=BAYES_50,RCVD_IN_DNSWL_NONE,
 RECEIVED_FROM_WINDOWS_HOST autolearn=disabled version=3.3.2
Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71)
 (envelope-from <raul.cardoso.lopes@HIDDEN>) id 1iCS1o-0001Bc-GV
 for bug-guix@HIDDEN; Mon, 23 Sep 2019 13:21:37 -0400
Received: from mail-eopbgr10044.outbound.protection.outlook.com
 ([40.107.1.44]:18437 helo=EUR02-HE1-obe.outbound.protection.outlook.com)
 by eggs.gnu.org with esmtps (TLS1.0:RSA_AES_256_CBC_SHA1:32)
 (Exim 4.71) (envelope-from <raul.cardoso.lopes@HIDDEN>)
 id 1iCS1o-0001AP-4n
 for bug-guix@HIDDEN; Mon, 23 Sep 2019 13:21:36 -0400
ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none;
 b=WgXQ9DDdiZ4nTGNUtuqHjSQeodeX9mMeF3f+stkqtCHdQk9zyw+xsdXz5IaiTLo+jS4qwOVC8HhKQN7yrWzvy+IkhlsAOLu+XjBS5CmG/qyViW+UxVzGzv8pmFHFTwgFdCKkRkTxldmYAd8e4Xu7pMkBShCCcG+Cnw1m/qrFC+SM65ywEWjndA1cAOq+FlljMh6P6sQ+rXnOQHLOnB1F0U6dPpgTX++MKNWP1wfyljvGbjlKUW4iFuM6dh8B9owIFiqDWmoQIJvLAy1ahaobLRZfQO2JmZEaXxt4PsXUxkLXyWyu1Tec83yik5SLgj2ZrwsSxQ++D6e+9fGJ7z1qDw==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; 
 s=arcselector9901;
 h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck;
 bh=kkU2YJ/HN7wHnlNNPyjXJP2iQy7ksCSFAOVbyJN3svs=;
 b=XpdtCIutW/2IybTPW8Goy4pcpYFIzM1v71XRjXfV5fx8iy3J4a+yITVE3bR3Lc1Yldi1u7+oLnQ2D0DOXVFzD68Z0m9qdljOW6cn3GWAPZyYzjneJl1P1GcZYJBc98ByfTQjTNY3YRSBV3yDMa5QKbdgdFbDtETbBkO9bS49W2QvQJBbvDf7/Pr/MojyEU+RYjNC++rNEF6C8rNjis+gJtrvDhOlqIXmRAnagNX6jXv+HKCweF4mlO123CGRY7jFZ2HEiPvk5MhrbPk70eYZrBfZC9owCfu1WRZKro56yorYw7qwps9g+dFOEg71AyplNH6a+euA7MmfsFOda3n2Uw==
ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass (sender ip is
 188.184.36.48) smtp.rcpttodomain=gnu.org smtp.mailfrom=cern.ch;
 dmarc=bestguesspass action=none header.from=cern.ch; dkim=none (message not
 signed); arc=none
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=cern.onmicrosoft.com; 
 s=selector2-cern-onmicrosoft-com;
 h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck;
 bh=kkU2YJ/HN7wHnlNNPyjXJP2iQy7ksCSFAOVbyJN3svs=;
 b=AE6QTiRnGHXjnTYOEmqrgBKKBQJ1TErVrnkzokaSKUWMjjLf9kSTzfouPsx5/tg3qMJTy8REVw+ppHYcSUiOgqVh68G0EEnCZYHP09ONcEwHbZ+wHN4HNZ2f/cMWpwPI4NzW2+qOQL8nOpeaQ3Ezl4eLcY7msT3uAv+YqAwpddg=
Received: from AM0PR06CA0043.eurprd06.prod.outlook.com (2603:10a6:208:aa::20)
 by AM6PR06MB6022.eurprd06.prod.outlook.com (2603:10a6:20b:98::10)
 with Microsoft SMTP Server (version=TLS1_2,
 cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.2284.20; Mon, 23 Sep
 2019 17:21:33 +0000
Received: from VE1EUR02FT009.eop-EUR02.prod.protection.outlook.com
 (2a01:111:f400:7e06::207) by AM0PR06CA0043.outlook.office365.com
 (2603:10a6:208:aa::20) with Microsoft SMTP Server (version=TLS1_2,
 cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.2284.18 via Frontend
 Transport; Mon, 23 Sep 2019 17:21:33 +0000
Authentication-Results: spf=pass (sender IP is 188.184.36.48)
 smtp.mailfrom=cern.ch; gnu.org; dkim=none (message not signed)
 header.d=none;gnu.org; dmarc=bestguesspass action=none header.from=cern.ch;
Received-SPF: Pass (protection.outlook.com: domain of cern.ch designates
 188.184.36.48 as permitted sender) receiver=protection.outlook.com;
 client-ip=188.184.36.48; helo=cernmxgwlb4.cern.ch;
Received: from cernmxgwlb4.cern.ch (188.184.36.48) by
 VE1EUR02FT009.mail.protection.outlook.com (10.152.12.226) with Microsoft SMTP
 Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id
 15.20.2284.20 via Frontend Transport; Mon, 23 Sep 2019 17:21:32 +0000
Received: from cernfe02.cern.ch (188.184.36.47) by cernmxgwlb4.cern.ch
 (188.184.36.48) with Microsoft SMTP Server (TLS) id 14.3.439.0; Mon, 23 Sep
 2019 19:21:32 +0200
Received: from [192.168.178.25] (88.98.86.77) by smtp.cern.ch (188.184.36.52)
 with Microsoft SMTP Server (TLS) id 14.3.468.0;
 Mon, 23 Sep 2019 19:21:31 +0200
To: <bug-guix@HIDDEN>
From: RAUL H C LOPES <rlopes@HIDDEN>
Subject: GUIXSD 1.0.1 install error
Message-ID: <4b7c7353-c7b0-8ced-c71d-0d4396096c74@HIDDEN>
Date: Mon, 23 Sep 2019 18:21:31 +0100
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:60.0) Gecko/20100101
 Thunderbird/60.8.0
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"; format=flowed
Content-Transfer-Encoding: 7bit
Content-Language: en-US
X-Originating-IP: [88.98.86.77]
X-EOPAttributedMessage: 0
X-Forefront-Antispam-Report: CIP:188.184.36.48; IPV:NLI; CTRY:CH; EFV:NLI;
 SFV:NSPM;
 SFS:(10009020)(979002)(376002)(39860400002)(396003)(136003)(346002)(189003)(199004)(58126008)(50466002)(316002)(478600001)(36756003)(31696002)(230700001)(70586007)(65956001)(65806001)(70206006)(66066001)(31686004)(26005)(7636002)(7736002)(305945005)(6116002)(3846002)(16576012)(14444005)(246002)(6916009)(486006)(186003)(2486003)(16526019)(23676004)(558084003)(47776003)(2906002)(956004)(2616005)(8676002)(126002)(356004)(8936002)(426003)(476003)(5660300002)(2351001)(106002)(336012)(7116003)(969003)(989001)(999001)(1009001)(1019001);
 DIR:OUT; SFP:1101; SCL:1; SRVR:AM6PR06MB6022; H:cernmxgwlb4.cern.ch; FPR:;
 SPF:Pass; LANG:en; PTR:cernmx12.cern.ch; MX:1; A:1; 
X-MS-PublicTrafficType: Email
X-MS-Office365-Filtering-Correlation-Id: 1c4a32e2-6433-4339-132f-08d7404a7adc
X-Microsoft-Antispam: BCL:0; PCL:0;
 RULEID:(2390118)(7020095)(4652040)(8989299)(5600167)(711020)(4605104)(4709080)(1401327)(4534185)(4627221)(201703031133081)(201702281549075)(8990200)(2017052603328)(7193020);
 SRVR:AM6PR06MB6022; 
X-MS-TrafficTypeDiagnostic: AM6PR06MB6022:
X-Microsoft-Antispam-PRVS: <AM6PR06MB602238561A3BE627D1979AB7CD850@HIDDEN>
X-MS-Oob-TLC-OOBClassifiers: OLM:4714;
X-Forefront-PRVS: 0169092318
X-MS-Exchange-SenderADCheck: 1
X-Microsoft-Antispam-Message-Info: O5C5Y3dfYZagpUsZU4fOOmerqUA8L7saC/HacUmxOEKOfcIQtlrk1jRAFR48raaC9UKfrZVqg+/QgFdpbCMOrJr9pmRElLSsiEwdUskiamxpe5CER6Tgr4ULXLslj7x07lLtuLGgW0nISvSHKbOZDWD0w930Ukzk6ApMT/hpjegb7on12UPu15iPnx70ztQrX6kX44Anwyiv3RfJgwsyCbmhuKTeEQi/o1NZ6swEXwtVIkWjZ5pufVgiM0QYvm0bvMXTUQAGs8bGoti8MlF1b01ae4LO6xyrHIJPRMZGSdLmxjEaoEKNY2pQ3ceXTldOs89M5/FJ1mpkEjWXg2hF6uEnH+VGIi6l8dBTwuKQG9oWdFuHR5r5xc8wgI3PONT1L5dQO8PSZ6IB/uik+BP8hTw+5cAXPg5n3UosZOp7PXQ=
X-OriginatorOrg: cern.ch
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 23 Sep 2019 17:21:32.5892 (UTC)
X-MS-Exchange-CrossTenant-Network-Message-Id: 1c4a32e2-6433-4339-132f-08d7404a7adc
X-MS-Exchange-CrossTenant-Id: c80d3499-4a40-4a8c-986e-abce017d6b19
X-MS-Exchange-CrossTenant-OriginalAttributedTenantConnectingIp: TenantId=c80d3499-4a40-4a8c-986e-abce017d6b19; Ip=[188.184.36.48];
 Helo=[cernmxgwlb4.cern.ch]
X-MS-Exchange-CrossTenant-FromEntityHeader: HybridOnPrem
X-MS-Exchange-Transport-CrossTenantHeadersStamped: AM6PR06MB6022
X-detected-operating-system: by eggs.gnu.org: Windows 7 or 8 [fuzzy]
X-Received-From: 40.107.1.44
X-Spam-Score: -1.6 (-)
X-Debbugs-Envelope-To: submit
X-Mailman-Approved-At: Mon, 23 Sep 2019 13:43:40 -0400
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, 
 <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, 
 <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -2.6 (--)

Hi,


I am trying to install GUIX SD and getting an error 1a6a140 "Unable to 
to locate keymap update file". I am trying to install UK English, UK 
keyb with Win keys: .
(locale "en_GB.utf8")


Showing in the configuration config.scm

Regards, Raul





Acknowledgement sent to RAUL H C LOPES <rlopes@HIDDEN>:
New bug report received and forwarded. Copy sent to bug-guix@HIDDEN. Full text available.
Report forwarded to bug-guix@HIDDEN:
bug#37492; Package guix. Full text available.
Please note: This is a static page, with minimal formatting, updated once a day.
Click here to see this page with the latest information and nicer formatting.
Last modified: Sun, 29 Sep 2019 12:15:02 UTC

GNU bug tracking system
Copyright (C) 1999 Darren O. Benham, 1997 nCipher Corporation Ltd, 1994-97 Ian Jackson.