X-Loop: help-debbugs@HIDDEN
Subject: bug#38658: perl-mode: EOF in same color as here doc text
Resent-From: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson <jidanni@HIDDEN>
Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
Resent-CC: bug-gnu-emacs@HIDDEN
Resent-Date: Wed, 18 Dec 2019 13:43:01 +0000
Resent-Message-ID: <handler.38658.B.15766765435944 <at> debbugs.gnu.org>
Resent-Sender: help-debbugs@HIDDEN
X-GNU-PR-Message: report 38658
X-GNU-PR-Package: emacs
X-GNU-PR-Keywords:
To: 38658 <at> debbugs.gnu.org
X-Debbugs-Original-To: bug-gnu-emacs@HIDDEN
Received: via spool by submit <at> debbugs.gnu.org id=B.15766765435944
(code B ref -1); Wed, 18 Dec 2019 13:43:01 +0000
Received: (at submit) by debbugs.gnu.org; 18 Dec 2019 13:42:23 +0000
Received: from localhost ([127.0.0.1]:42771 helo=debbugs.gnu.org)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
id 1ihZap-0001Xo-03
for submit <at> debbugs.gnu.org; Wed, 18 Dec 2019 08:42:23 -0500
Received: from lists.gnu.org ([209.51.188.17]:38918)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <jidanni@HIDDEN>) id 1ihZam-0001Xh-7q
for submit <at> debbugs.gnu.org; Wed, 18 Dec 2019 08:42:21 -0500
Received: from eggs.gnu.org ([2001:470:142:3::10]:60723)
by lists.gnu.org with esmtp (Exim 4.90_1)
(envelope-from <jidanni@HIDDEN>) id 1ihZak-00066c-VY
for bug-gnu-emacs@HIDDEN; Wed, 18 Dec 2019 08:42:20 -0500
X-Spam-Checker-Version: SpamAssassin 3.3.2 (2011-06-06) on eggs.gnu.org
X-Spam-Level:
X-Spam-Status: No, score=0.8 required=5.0 tests=BAYES_50,RCVD_IN_DNSWL_NONE,
URIBL_BLOCKED autolearn=disabled version=3.3.2
Received: from Debian-exim by eggs.gnu.org with spam-scanned (Exim 4.71)
(envelope-from <jidanni@HIDDEN>) id 1ihZaj-0001j6-NV
for bug-gnu-emacs@HIDDEN; Wed, 18 Dec 2019 08:42:18 -0500
Received: from chocolate.birch.relay.mailchannels.net ([23.83.209.35]:57480)
by eggs.gnu.org with esmtps (TLS1.0:DHE_RSA_AES_256_CBC_SHA1:32)
(Exim 4.71) (envelope-from <jidanni@HIDDEN>) id 1ihZaj-0001Vr-9T
for bug-gnu-emacs@HIDDEN; Wed, 18 Dec 2019 08:42:17 -0500
X-Sender-Id: dreamhost|x-authsender|jidanni@HIDDEN
Received: from relay.mailchannels.net (localhost [127.0.0.1])
by relay.mailchannels.net (Postfix) with ESMTP id 157DF34150B
for <bug-gnu-emacs@HIDDEN>; Wed, 18 Dec 2019 13:42:15 +0000 (UTC)
Received: from pdx1-sub0-mail-a98.g.dreamhost.com
(100-96-15-224.trex.outbound.svc.cluster.local [100.96.15.224])
(Authenticated sender: dreamhost)
by relay.mailchannels.net (Postfix) with ESMTPA id 99C273416F6
for <bug-gnu-emacs@HIDDEN>; Wed, 18 Dec 2019 13:42:14 +0000 (UTC)
X-Sender-Id: dreamhost|x-authsender|jidanni@HIDDEN
Received: from pdx1-sub0-mail-a98.g.dreamhost.com ([TEMPUNAVAIL].
[64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384)
by 0.0.0.0:2500 (trex/5.18.5); Wed, 18 Dec 2019 13:42:15 +0000
X-MC-Relay: Neutral
X-MailChannels-SenderId: dreamhost|x-authsender|jidanni@HIDDEN
X-MailChannels-Auth-Id: dreamhost
X-Fumbling-Army: 630905b32e4a07d7_1576676534866_990541311
X-MC-Loop-Signature: 1576676534866:3658345823
X-MC-Ingress-Time: 1576676534866
Received: from pdx1-sub0-mail-a98.g.dreamhost.com (localhost [127.0.0.1])
by pdx1-sub0-mail-a98.g.dreamhost.com (Postfix) with ESMTP id 346307F5C0
for <bug-gnu-emacs@HIDDEN>; Wed, 18 Dec 2019 05:42:09 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=jidanni.org; h=from:to
:subject:date:message-id:mime-version:content-type; s=
jidanni.org; bh=CfFawVF3oe4vStIx9oFE7NJDS8k=; b=bgfEwWi5fp4FMQYq
iPf2ouZD3Lf5UZ3Buqx2qXRYkgicdyLXwzNaxRq1Ze5IuklejrrLIkwJiU+jj7Sh
ESrTzQPgq/Pt8tLM69gyi983ak7wGnn4WXaMOaGlK5d7oEI7PkcB2hnu3yrL1R33
muvX/yL4xtX7ucaRFnHQb8Yc9tU=
Received: from jidanni.org (1-170-85-72.dynamic-ip.hinet.net [1.170.85.72])
(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))
(No client certificate requested)
(Authenticated sender: jidanni@HIDDEN)
by pdx1-sub0-mail-a98.g.dreamhost.com (Postfix) with ESMTPSA id 120507F247
for <bug-gnu-emacs@HIDDEN>; Wed, 18 Dec 2019 05:42:07 -0800 (PST)
X-DH-BACKEND: pdx1-sub0-mail-a98
From: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson <jidanni@HIDDEN>
Date: Wed, 18 Dec 2019 21:39:13 +0800
Message-ID: <871rt1oiri.5.fsf@HIDDEN>
MIME-Version: 1.0
Content-Type: text/plain
X-VR-OUT-STATUS: OK
X-VR-OUT-SCORE: 0
X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedufedrvddtledgheefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpffftgfetoffjqffuvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffufffkgggtsehttdertddttdejnecuhfhrohhmpejnnjjnucffrghnucflrggtohgsshhonhcuoehjihgurghnnhhisehjihgurghnnhhirdhorhhgqeenucfkphepuddrudejtddrkeehrdejvdenucfrrghrrghmpehmohguvgepshhmthhppdhhvghlohepjhhiuggrnhhnihdrohhrghdpihhnvghtpedurddujedtrdekhedrjedvpdhrvghtuhhrnhdqphgrthhhpeeprehuthhfqdekreeureehiehmpfehnfhiheehsgevkeerpecuffgrnhculfgrtghosghsohhnuceojhhiuggrnhhnihesjhhiuggrnhhnihdrohhrgheqpdhmrghilhhfrhhomhepjhhiuggrnhhnihesjhhiuggrnhhnihdrohhrghdpnhhrtghpthhtohepsghughdqghhnuhdqvghmrggtshesghhnuhdrohhrghenucevlhhushhtvghrufhiiigvpedt
X-detected-operating-system: by eggs.gnu.org: GNU/Linux 2.2.x-3.x [generic]
[fuzzy]
X-Received-From: 23.83.209.35
X-Spam-Score: -1.4 (-)
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -2.4 (--)
$ nl e.pl
1 print <<EOF;
2 bla
3 EOF
$ emacs e.pl
Why is line 1 in color A, and lines 2 and 3 in color B?
How about instead lines 1 and 3 in color A, and line 2 in color B?
emacs-version "26.3"
Content-Disposition: inline Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) Content-Type: text/plain; charset=utf-8 X-Loop: help-debbugs@HIDDEN From: help-debbugs@HIDDEN (GNU bug Tracking System) To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson <jidanni@HIDDEN> Subject: bug#38658: Acknowledgement (perl-mode: EOF in same color as here doc text) Message-ID: <handler.38658.B.15766765435944.ack <at> debbugs.gnu.org> References: <871rt1oiri.5.fsf@HIDDEN> X-Gnu-PR-Message: ack 38658 X-Gnu-PR-Package: emacs Reply-To: 38658 <at> debbugs.gnu.org Date: Wed, 18 Dec 2019 13:43:02 +0000 Thank you for filing a new bug report with debbugs.gnu.org. This is an automatically generated reply to let you know your message has been received. Your message is being forwarded to the package maintainers and other interested parties for their attention; they will reply in due course. Your message has been sent to the package maintainer(s): bug-gnu-emacs@HIDDEN If you wish to submit further information on this problem, please send it to 38658 <at> debbugs.gnu.org. Please do not send mail to help-debbugs@HIDDEN unless you wish to report a problem with the Bug-tracking system. --=20 38658: http://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D38658 GNU Bug Tracking System Contact help-debbugs@HIDDEN with problems
X-Loop: help-debbugs@HIDDEN
Subject: bug#38658: perl-mode: EOF in same color as here doc text
Resent-From: Lars Ingebrigtsen <larsi@HIDDEN>
Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
Resent-CC: bug-gnu-emacs@HIDDEN
Resent-Date: Thu, 06 Aug 2020 10:33:02 +0000
Resent-Message-ID: <handler.38658.B38658.15967099297198 <at> debbugs.gnu.org>
Resent-Sender: help-debbugs@HIDDEN
X-GNU-PR-Message: followup 38658
X-GNU-PR-Package: emacs
X-GNU-PR-Keywords:
To: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson <jidanni@HIDDEN>
Cc: 38658 <at> debbugs.gnu.org, Stefan Monnier <monnier@HIDDEN>
Received: via spool by 38658-submit <at> debbugs.gnu.org id=B38658.15967099297198
(code B ref 38658); Thu, 06 Aug 2020 10:33:02 +0000
Received: (at 38658) by debbugs.gnu.org; 6 Aug 2020 10:32:09 +0000
Received: from localhost ([127.0.0.1]:53248 helo=debbugs.gnu.org)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
id 1k3dBx-0001rp-8E
for submit <at> debbugs.gnu.org; Thu, 06 Aug 2020 06:32:09 -0400
Received: from quimby.gnus.org ([95.216.78.240]:52164)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <larsi@HIDDEN>) id 1k3dBv-0001ka-5R
for 38658 <at> debbugs.gnu.org; Thu, 06 Aug 2020 06:32:08 -0400
DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnus.org;
s=20200322; h=Content-Transfer-Encoding:Content-Type:MIME-Version:Message-ID
:In-Reply-To:Date:References:Subject:Cc:To:From:Sender:Reply-To:Content-ID:
Content-Description:Resent-Date:Resent-From:Resent-Sender:Resent-To:Resent-Cc
:Resent-Message-ID:List-Id:List-Help:List-Unsubscribe:List-Subscribe:
List-Post:List-Owner:List-Archive;
bh=Vu4MsAiMz0Bo6s5a7wun3xRG1Pl/tdACcemoOpWXA/8=; b=I/ezVW9tNV4W1e8cZq5PaQGUBm
FNfT476+acKWxaJEmV/ikFoHMg31n+wMCHNRloV/UhS41PwfixkKnUIeMxUB4O0adHkzUMdZVaImT
i5rG4WWV4do91lhpNt54wGS5imdBw8uycPRSvLmyRBaxmFMCqTf0YjTguvwSlxWFzQP8=;
Received: from cm-84.212.202.86.getinternet.no ([84.212.202.86] helo=xo)
by quimby with esmtpsa (TLS1.3:ECDHE_RSA_AES_256_GCM_SHA384:256)
(Exim 4.92) (envelope-from <larsi@HIDDEN>)
id 1k3dBl-0000HT-F7; Thu, 06 Aug 2020 12:32:00 +0200
From: Lars Ingebrigtsen <larsi@HIDDEN>
References: <871rt1oiri.5.fsf@HIDDEN>
Date: Thu, 06 Aug 2020 12:31:55 +0200
In-Reply-To: <871rt1oiri.5.fsf@HIDDEN> ("=?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?=
Dan Jacobson"'s message of "Wed, 18 Dec 2019 21:39:13 +0800")
Message-ID: <87lfisdq04.fsf@HIDDEN>
User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/28.0.50 (gnu/linux)
MIME-Version: 1.0
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable
X-Spam-Report: Spam detection software, running on the system "quimby.gnus.org",
has NOT identified this incoming email as spam. The original
message has been attached to this so you can view it or label
similar future email. If you have any questions, see
@@CONTACT_ADDRESS@@ for details.
Content preview: =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson <jidanni@HIDDEN> writes: > $ nl
e.pl > 1 print <<EOF; > 2 bla > 3 EOF > $ emacs e.pl > > Why is line 1 in
color A, and lines 2 and 3 in color B? > How about instead lines 1 and 3
in color A, and line 2 in color B?
Content analysis details: (-2.9 points, 5.0 required)
pts rule name description
---- ---------------------- --------------------------------------------------
-1.0 ALL_TRUSTED Passed through trusted hosts only via SMTP
-1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1%
[score: 0.0000]
X-Spam-Score: 0.0 (/)
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -1.0 (-)
=E7=A9=8D=E4=B8=B9=E5=B0=BC Dan Jacobson <jidanni@HIDDEN> writes:
> $ nl e.pl
> 1 print <<EOF;
> 2 bla
> 3 EOF
> $ emacs e.pl
>
> Why is line 1 in color A, and lines 2 and 3 in color B?
> How about instead lines 1 and 3 in color A, and line 2 in color B?
This is apparently due to the following code:
(defun perl-syntax-propertize-special-constructs (limit)
[...]
;; A Here document.
(let ((names (cdr (get-text-property (nth 8 state) 'syntax-table))))
(when (cdr names)
(setq names (reverse names))
;; Multiple heredocs on a single line, we have to search from the
;; beginning, since we don't know which names might be
;; before point.
(goto-char (nth 8 state)))
(while (and names
(re-search-forward
(pcase-let ((`(,name . ,indented) (pop names)))
(concat "^" (if indented "[ \t]*")
(regexp-quote name) "\n"))
limit 'move))
(unless names
(put-text-property (1- (point)) (point) 'syntax-table
(string-to-syntax "> c"))))))
We apparently want to put that syntax on at the end of the heredoc, but
stop fontifying at the start of the final EOF. I poked around a bit in
the code to see whether I could make it do that, and... I can't.
So I'm Cc-ing Stefan, who wrote this. :-)
--=20
(domestic pets only, the antidote for overdose, milk.)
bloggy blog: http://lars.ingebrigtsen.no
Received: (at control) by debbugs.gnu.org; 6 Aug 2020 10:32:16 +0000 From debbugs-submit-bounces <at> debbugs.gnu.org Thu Aug 06 06:32:16 2020 Received: from localhost ([127.0.0.1]:53251 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1k3dC4-0001xO-Gz for submit <at> debbugs.gnu.org; Thu, 06 Aug 2020 06:32:16 -0400 Received: from quimby.gnus.org ([95.216.78.240]:52182) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <larsi@HIDDEN>) id 1k3dC2-0001ri-B7 for control <at> debbugs.gnu.org; Thu, 06 Aug 2020 06:32:14 -0400 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnus.org; s=20200322; h=Subject:From:To:Message-Id:Date:Sender:Reply-To:Cc: MIME-Version:Content-Type:Content-Transfer-Encoding:Content-ID: Content-Description:Resent-Date:Resent-From:Resent-Sender:Resent-To:Resent-Cc :Resent-Message-ID:In-Reply-To:References:List-Id:List-Help:List-Unsubscribe: List-Subscribe:List-Post:List-Owner:List-Archive; bh=kIpAXhBL1oNF/33L4F5VvlOrtzbK2fZlik1bNY5/ui4=; b=JaAsEGs1asLX7UeySAtCHmBdGI heqDGGeZk6POnLdzt1pGX/9aHlHM4iQBC0walYgXfKSmO5xppt8lUthrjVJ/Q3Rsz9nwi0O7d/Jie v2PTNMaDBXsqE5FrJ5lu8NTwJGZ0vqXR2d9r4IOy1Wi5UaeVmaOFuUOiIK9KWLeC0p/Y=; Received: from cm-84.212.202.86.getinternet.no ([84.212.202.86] helo=xo) by quimby with esmtpsa (TLS1.3:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.92) (envelope-from <larsi@HIDDEN>) id 1k3dBu-0000He-In for control <at> debbugs.gnu.org; Thu, 06 Aug 2020 12:32:08 +0200 Date: Thu, 06 Aug 2020 12:32:05 +0200 Message-Id: <87k0ycdpzu.fsf@HIDDEN> To: control <at> debbugs.gnu.org From: Lars Ingebrigtsen <larsi@HIDDEN> Subject: control message for bug #38658 X-Spam-Report: Spam detection software, running on the system "quimby.gnus.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: tags 38658 + confirmed quit Content analysis details: (-2.9 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -1.0 ALL_TRUSTED Passed through trusted hosts only via SMTP -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% [score: 0.0000] X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: control X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) tags 38658 + confirmed quit
X-Loop: help-debbugs@HIDDEN
Subject: bug#38658: perl-mode: EOF in same color as here doc text
Resent-From: Stefan Monnier <monnier@HIDDEN>
Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
Resent-CC: bug-gnu-emacs@HIDDEN
Resent-Date: Thu, 06 Aug 2020 14:40:01 +0000
Resent-Message-ID: <handler.38658.B38658.159672475810320 <at> debbugs.gnu.org>
Resent-Sender: help-debbugs@HIDDEN
X-GNU-PR-Message: followup 38658
X-GNU-PR-Package: emacs
X-GNU-PR-Keywords: confirmed
To: Lars Ingebrigtsen <larsi@HIDDEN>
Cc: 38658 <at> debbugs.gnu.org, =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson <jidanni@HIDDEN>
Received: via spool by 38658-submit <at> debbugs.gnu.org id=B38658.159672475810320
(code B ref 38658); Thu, 06 Aug 2020 14:40:01 +0000
Received: (at 38658) by debbugs.gnu.org; 6 Aug 2020 14:39:18 +0000
Received: from localhost ([127.0.0.1]:54699 helo=debbugs.gnu.org)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
id 1k3h37-0002gO-Nh
for submit <at> debbugs.gnu.org; Thu, 06 Aug 2020 10:39:17 -0400
Received: from mailscanner.iro.umontreal.ca ([132.204.25.50]:18909)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <monnier@HIDDEN>) id 1k3h35-0002g9-DO
for 38658 <at> debbugs.gnu.org; Thu, 06 Aug 2020 10:39:15 -0400
Received: from pmg3.iro.umontreal.ca (localhost [127.0.0.1])
by pmg3.iro.umontreal.ca (Proxmox) with ESMTP id A1C98440FFB;
Thu, 6 Aug 2020 10:39:09 -0400 (EDT)
Received: from mail01.iro.umontreal.ca (unknown [172.31.2.1])
by pmg3.iro.umontreal.ca (Proxmox) with ESMTP id 22568440FE5;
Thu, 6 Aug 2020 10:39:08 -0400 (EDT)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=iro.umontreal.ca;
s=mail; t=1596724748;
bh=2X72gzqnRhdqxODHnm9jZPdznLWMBxFNkz9ClRU7IFE=;
h=From:To:Cc:Subject:References:Date:In-Reply-To:From;
b=KnMGNmN1kiPFKIZgL5qbq8c6rHg8Fx3TEo6lDxGiuV/CBz68ZNmp9qJOYjbjlPgB0
nX13Q1oeu6IzPHhgM0cqacAunJvG5Y4qAJX8RY5emTuY/9/vl06yl/RCG4CRHWJHyf
wB5LIrT31cNm5KgIQgZFPywJ/bnu7EXYnNl5b6wNix7DGGLWO9xsdKdvfkIRVHaTYX
biKqV2XVucqf+5TnRkmANtwRX/eAk5rOfCsLMEU2FwdmrTJVN1PuImoFEKkFv6KUYZ
SAplrxFJSk/6fl3C7j4wcujYAJGbKQ98+cKFLtAG1YJ3cVR40IQYeD5jPX0FfR4aEV
RYKGgo/LNRE2w==
Received: from milanesa (unknown [45.72.246.108])
by mail01.iro.umontreal.ca (Postfix) with ESMTPSA id D8BE51207B8;
Thu, 6 Aug 2020 10:39:07 -0400 (EDT)
From: Stefan Monnier <monnier@HIDDEN>
Message-ID: <jwvk0yb265y.fsf-monnier+emacs@HIDDEN>
References: <871rt1oiri.5.fsf@HIDDEN> <87lfisdq04.fsf@HIDDEN>
Date: Thu, 06 Aug 2020 10:39:00 -0400
In-Reply-To: <87lfisdq04.fsf@HIDDEN> (Lars Ingebrigtsen's message of "Thu,
06 Aug 2020 12:31:55 +0200")
User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/28.0.50 (gnu/linux)
MIME-Version: 1.0
Content-Type: text/plain
X-SPAM-INFO: Spam detection results: 0
ALL_TRUSTED -1 Passed through trusted hosts only via SMTP
AWL 0.001 Adjusted score from AWL reputation of From: address
BAYES_00 -1.9 Bayes spam probability is 0 to 1%
DKIM_SIGNED 0.1 Message has a DKIM or DK signature,
not necessarily valid
DKIM_VALID -0.1 Message has at least one valid DKIM or DK signature
DKIM_VALID_AU -0.1 Message has a valid DKIM or DK signature from author's
domain
X-SPAM-LEVEL:
X-Spam-Score: -2.3 (--)
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -3.3 (---)
First, I'll note that all the rest of font-lock highlights the comment
and string delimiters the same as the comment and string contents,
except for the `font-lock-comment-delimiter-face`, so you might like to
check how `font-lock-comment-delimiter-face` is done.
> We apparently want to put that syntax on at the end of the heredoc, but
> stop fontifying at the start of the final EOF.
Rather than "not fontify" the delimiter, I think it'll be much easier to
add extra fontification to it.
Stefan
X-Loop: help-debbugs@HIDDEN
Subject: bug#38658: perl-mode: EOF in same color as here doc text
Resent-From: Lars Ingebrigtsen <larsi@HIDDEN>
Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
Resent-CC: bug-gnu-emacs@HIDDEN
Resent-Date: Fri, 07 Aug 2020 06:50:02 +0000
Resent-Message-ID: <handler.38658.B38658.159678299113026 <at> debbugs.gnu.org>
Resent-Sender: help-debbugs@HIDDEN
X-GNU-PR-Message: followup 38658
X-GNU-PR-Package: emacs
X-GNU-PR-Keywords: confirmed
To: Stefan Monnier <monnier@HIDDEN>
Cc: 38658 <at> debbugs.gnu.org, =?UTF-8?Q?=E7=A9=8D=E4=B8=B9=E5=B0=BC?= Dan Jacobson <jidanni@HIDDEN>
Received: via spool by 38658-submit <at> debbugs.gnu.org id=B38658.159678299113026
(code B ref 38658); Fri, 07 Aug 2020 06:50:02 +0000
Received: (at 38658) by debbugs.gnu.org; 7 Aug 2020 06:49:51 +0000
Received: from localhost ([127.0.0.1]:55529 helo=debbugs.gnu.org)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>)
id 1k3wCN-0003O1-9L
for submit <at> debbugs.gnu.org; Fri, 07 Aug 2020 02:49:51 -0400
Received: from quimby.gnus.org ([95.216.78.240]:35250)
by debbugs.gnu.org with esmtp (Exim 4.84_2)
(envelope-from <larsi@HIDDEN>) id 1k3wCK-0003No-8w
for 38658 <at> debbugs.gnu.org; Fri, 07 Aug 2020 02:49:49 -0400
DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnus.org;
s=20200322; h=Content-Type:MIME-Version:Message-ID:In-Reply-To:Date:
References:Subject:Cc:To:From:Sender:Reply-To:Content-Transfer-Encoding:
Content-ID:Content-Description:Resent-Date:Resent-From:Resent-Sender:
Resent-To:Resent-Cc:Resent-Message-ID:List-Id:List-Help:List-Unsubscribe:
List-Subscribe:List-Post:List-Owner:List-Archive;
bh=OiOP5bhTaRXkiXe804imcVXmN30A/Gm6kyBoW9Pq5do=; b=smcVxC5SckKYc1Ne6nsXBsMVKd
rDjcE9yIBPfeALVvrQt/YB5SbEqW5PxoAUVjnMpAu/tjMG6lJDXZ+meZcFUUd1swE3tatUCuHuooS
bPSKyH69+lotu56J5d4YFQkcODVVHaXVW+zdUbTyaKYhw7Q3WSMVD2SyGIzs8k4nr4WI=;
Received: from cm-84.212.202.86.getinternet.no ([84.212.202.86] helo=xo)
by quimby with esmtpsa (TLS1.3:ECDHE_RSA_AES_256_GCM_SHA384:256)
(Exim 4.92) (envelope-from <larsi@HIDDEN>)
id 1k3wC6-0003qV-BT; Fri, 07 Aug 2020 08:49:40 +0200
From: Lars Ingebrigtsen <larsi@HIDDEN>
References: <871rt1oiri.5.fsf@HIDDEN> <87lfisdq04.fsf@HIDDEN>
<jwvk0yb265y.fsf-monnier+emacs@HIDDEN>
Date: Fri, 07 Aug 2020 08:49:32 +0200
In-Reply-To: <jwvk0yb265y.fsf-monnier+emacs@HIDDEN> (Stefan Monnier's message
of "Thu, 06 Aug 2020 10:39:00 -0400")
Message-ID: <87r1sj7xxf.fsf@HIDDEN>
User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/28.0.50 (gnu/linux)
MIME-Version: 1.0
Content-Type: text/plain
X-Spam-Report: Spam detection software, running on the system "quimby.gnus.org",
has NOT identified this incoming email as spam. The original
message has been attached to this so you can view it or label
similar future email. If you have any questions, see
@@CONTACT_ADDRESS@@ for details.
Content preview: Stefan Monnier <monnier@HIDDEN> writes: > First,
I'll note that all the rest of font-lock highlights the comment > and string
delimiters the same as the comment and string contents, > except for the
`font-lock-comment-delimiter-face`, so yo [...]
Content analysis details: (-2.9 points, 5.0 required)
pts rule name description
---- ---------------------- --------------------------------------------------
-1.0 ALL_TRUSTED Passed through trusted hosts only via SMTP
-1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1%
[score: 0.0000]
X-Spam-Score: 0.0 (/)
X-BeenThere: debbugs-submit <at> debbugs.gnu.org
X-Mailman-Version: 2.1.18
Precedence: list
List-Id: <debbugs-submit.debbugs.gnu.org>
List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe>
List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/>
List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org>
List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help>
List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>,
<mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe>
Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org
Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org>
X-Spam-Score: -1.0 (-)
Stefan Monnier <monnier@HIDDEN> writes:
> First, I'll note that all the rest of font-lock highlights the comment
> and string delimiters the same as the comment and string contents,
> except for the `font-lock-comment-delimiter-face`, so you might like to
> check how `font-lock-comment-delimiter-face` is done.
Hm, right...
I just noticed that heredocs in .sh files are fontified identically to
in Perl-mode, by the way.
>> We apparently want to put that syntax on at the end of the heredoc, but
>> stop fontifying at the start of the final EOF.
>
> Rather than "not fontify" the delimiter, I think it'll be much easier to
> add extra fontification to it.
Right.
--
(domestic pets only, the antidote for overdose, milk.)
bloggy blog: http://lars.ingebrigtsen.no
Received: (at control) by debbugs.gnu.org; 7 Aug 2020 10:12:13 +0000 From debbugs-submit-bounces <at> debbugs.gnu.org Fri Aug 07 06:12:13 2020 Received: from localhost ([127.0.0.1]:55784 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1k3zMC-0000P8-RI for submit <at> debbugs.gnu.org; Fri, 07 Aug 2020 06:12:13 -0400 Received: from quimby.gnus.org ([95.216.78.240]:37572) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <larsi@HIDDEN>) id 1k3zMB-0000Os-CU for control <at> debbugs.gnu.org; Fri, 07 Aug 2020 06:12:11 -0400 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnus.org; s=20200322; h=Subject:From:To:Message-Id:Date:Sender:Reply-To:Cc: MIME-Version:Content-Type:Content-Transfer-Encoding:Content-ID: Content-Description:Resent-Date:Resent-From:Resent-Sender:Resent-To:Resent-Cc :Resent-Message-ID:In-Reply-To:References:List-Id:List-Help:List-Unsubscribe: List-Subscribe:List-Post:List-Owner:List-Archive; bh=TfErHEm7IYi6xFAux6O2cZzies0VgNEgIb8wCjU19Ug=; b=Ub31Tx1H+WGTtZjkODf4ZjyyDH 6seWl67AqcrWeH25UH7+FRhmaxoGSSY0+Ytj9Sz2q04kWB5sCAhOdwW8WoQAvWcgMYTUHRRkGE01u BdeA3bwgOCz6DtM6Oo+7qgOEl4T/9BqTJbESv45uBVOxpso3/AsIjA0FMmLonJ1PWw8o=; Received: from cm-84.212.202.86.getinternet.no ([84.212.202.86] helo=xo) by quimby with esmtpsa (TLS1.3:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.92) (envelope-from <larsi@HIDDEN>) id 1k3zM3-0005mO-L5 for control <at> debbugs.gnu.org; Fri, 07 Aug 2020 12:12:05 +0200 Date: Fri, 07 Aug 2020 12:12:02 +0200 Message-Id: <87364y69zh.fsf@HIDDEN> To: control <at> debbugs.gnu.org From: Lars Ingebrigtsen <larsi@HIDDEN> Subject: control message for bug #38658 X-Spam-Report: Spam detection software, running on the system "quimby.gnus.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see @@CONTACT_ADDRESS@@ for details. Content preview: forcemerge 38658 17980 quit Content analysis details: (-2.9 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -1.0 ALL_TRUSTED Passed through trusted hosts only via SMTP -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% [score: 0.0000] X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: control X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) forcemerge 38658 17980 quit
GNU bug tracking system
Copyright (C) 1999 Darren O. Benham,
1997 nCipher Corporation Ltd,
1994-97 Ian Jackson.