Eli Zaretskii <eliz@HIDDEN>
to control <at> debbugs.gnu.org.
Full text available.Received: (at 63586) by debbugs.gnu.org; 19 May 2023 16:00:08 +0000 From debbugs-submit-bounces <at> debbugs.gnu.org Fri May 19 12:00:08 2023 Received: from localhost ([127.0.0.1]:57214 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1q02WW-00023o-AQ for submit <at> debbugs.gnu.org; Fri, 19 May 2023 12:00:08 -0400 Received: from eggs.gnu.org ([209.51.188.92]:51786) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <eliz@HIDDEN>) id 1q02WU-00021d-2T for 63586 <at> debbugs.gnu.org; Fri, 19 May 2023 12:00:06 -0400 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <eliz@HIDDEN>) id 1q02WN-0003XA-HB; Fri, 19 May 2023 11:59:59 -0400 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=09iWKHt8xgHcKIcB8ue9HPtGu+WsSQZJGd16Hmngwe0=; b=Z3O9BMhkiSTM3B3X8gcb emrwDpu8nQMJS+oZRVN3Mxl93lszGdt3Ul4+JXa2KCiB5+E7jvoyPeP6HlrFH4KNi/kdJN08qUQBI r16F/U9wCN20hdRU87sfv5mMOWq9GwY/O7PhbNHRXZogN8XVQ6WNKBNHkn/fboD/xZOpto2x1Jl9c qywSfbUYM089L621Zcq1F4kJKGV7syUWeO9a0cMFaIZh1l394nBXnfsnu72CdLDu5g0lkl5oKuxvZ qypIEeGIAxF5Zh1VlVsF74pfX0n9rW2AyEl7ej+1srvaJdK91pNw0idNC7CI/8+swi30GuQT5TL3E zoo25QnBxkTEtQ==; Received: from [87.69.77.57] (helo=home-c4e4a596f7) by fencepost.gnu.org with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <eliz@HIDDEN>) id 1q02WM-0003bi-Hg; Fri, 19 May 2023 11:59:59 -0400 Date: Fri, 19 May 2023 19:00:13 +0300 Message-Id: <83ednctipe.fsf@HIDDEN> From: Eli Zaretskii <eliz@HIDDEN> To: balducci@HIDDEN, Stefan Monnier <monnier@HIDDEN>, Mattias =?iso-8859-1?Q?Engdeg=E5rd?= <mattiase@HIDDEN> In-Reply-To: <4450.1684509068@HIDDEN> (balducci@HIDDEN) Subject: Re: bug#63586: 29.x: dotimes (possible) problem References: <4450.1684509068@HIDDEN> MIME-version: 1.0 Content-type: text/plain; charset=iso-8859-1 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-Debbugs-Envelope-To: 63586 Cc: 63586 <at> debbugs.gnu.org X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -3.3 (---) > From: balducci@HIDDEN > Date: Fri, 19 May 2023 17:10:44 +0200 > > the dotimes macro behaves differently in 29.x with respect to previous > versions > > Basically: changing the value of the loop variable in the body of > dotimes does not seem to have any effect, where for versions <29.x it > used to. > > Here is a minimal stretch of dummy code clarifying the problem I'm > reporting. > > emacs-29.0.91 (or 29.0.90) > ========================== > > (dotimes (ii 10) > (insert (format "%2d " ii)) > (when (= ii 4)(setq ii 11)) > ) > ==> 0 1 2 3 4 5 6 7 8 9 > > emacs-28.2 (or any version <29.x) > ================================= > > (dotimes (ii 10) > (insert (format "%2d " ii)) > (when (= ii 4)(setq ii 11)) > ) > ==> 0 1 2 3 4 I can only reproduce the behavior you see in 28.2 in Emacs 26.3. All the later versions, starting from 27.1, behave like Emacs 29 does. > The ability to jump out of the loop by pushing the loop variable over > the upper limit is something that I happen to use in my scripts, so > 29.x breaks them somehow > > Of course, there are very many other equivalent ways to > accomplish the same result, but I don't see why this one > shouldn't be supported (any longer) > > Is the changed behavior intentional? Am I missing some blatant point here? > > AFAICS, changing the value of the loop variable from inside the loop > body is supported by any other language which I know about Adding Stefan and Mattias who made changes in dotimes recently.
bug-gnu-emacs@HIDDEN:bug#63586; Package emacs.
Full text available.Received: (at 63586) by debbugs.gnu.org; 19 May 2023 15:55:02 +0000 From debbugs-submit-bounces <at> debbugs.gnu.org Fri May 19 11:55:01 2023 Received: from localhost ([127.0.0.1]:57209 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1q02RZ-0001rn-Gp for submit <at> debbugs.gnu.org; Fri, 19 May 2023 11:55:01 -0400 Received: from mail1447c50.megamailservers.eu ([91.136.14.47]:34988 helo=mail265c50.megamailservers.eu) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <mattiase@HIDDEN>) id 1q02RX-0001qo-G5 for 63586 <at> debbugs.gnu.org; Fri, 19 May 2023 11:55:00 -0400 X-Authenticated-User: mattiase@HIDDEN DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=megamailservers.eu; s=maildub; t=1684511692; bh=/Wpep1aUiJz4p6PCHALZKfVYchYUk4Z60bvrKECvHsU=; h=From:Subject:Date:Cc:To:From; b=nuXR+kdwUZcg2hx+C+J3YQDaU+x1gTDvTa6YrJP8/aaRjUvpvMAHxnMSbVp0C9Aba QsotMxDxojWgJwlyLv4AYwYOBfavmC8LWjXgbu8g3oP4ACD9t5q9+bycagHL2THjYE vDk6JZNth/6VLnitLGX0aTIHfUCrYCz03971Iq6E= Feedback-ID: mattiase@HIDDEN Received: from smtpclient.apple (c188-150-165-235.bredband.tele2.se [188.150.165.235]) (authenticated bits=0) by mail265c50.megamailservers.eu (8.14.9/8.13.1) with ESMTP id 34JFsnt1086688; Fri, 19 May 2023 15:54:51 +0000 From: =?utf-8?Q?Mattias_Engdeg=C3=A5rd?= <mattiase@HIDDEN> Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: quoted-printable Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.120.0.1.15\)) Subject: bug#63586: 29.x: dotimes (possible) problem Message-Id: <D0DD1925-FF93-44EF-83D4-56E970922F9C@HIDDEN> Date: Fri, 19 May 2023 17:54:48 +0200 To: balducci@HIDDEN X-Mailer: Apple Mail (2.3654.120.0.1.15) X-VADE-SPAMSTATE: clean X-VADE-SPAMSCORE: -100 X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvhedrfeeihedgleegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffquffvqffrkfetpdfqfgfvpdfgpfggqdevhedtnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhtgfgggfukfffvefvofesthhqmhdthhdtvdenucfhrhhomhepofgrthhtihgrshcugfhnghguvghgnohrugcuoehmrghtthhirghsvgesrggtmhdrohhrgheqnecuggftrfgrthhtvghrnhepudekueejlefgkeejjeegudevvefhgfekudeggedvfeejfefgleetjedtvedvhfeunecukfhppedukeekrdduhedtrdduieehrddvfeehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudekkedrudehtddrudeihedrvdefhedphhgvlhhopehsmhhtphgtlhhivghnthdrrghpphhlvgdpmhgrihhlfhhrohhmpehmrghtthhirghsvgesrggtmhdrohhrghdpnhgspghrtghpthhtohepgedprhgtphhtthhopegsrghlughutggtihesuhhnihhtshdrihhtpdhrtghpthhtohepieefheekieesuggvsggsuhhgshdrghhnuhdrohhrghdprhgtphhtthhopegvlhhiiiesghhnuhdrohhrghdprhgtphhtthhopehmohhnnhhivghrsehirhhordhumhhonhhtrhgvrghlrdgtrg X-Origin-Country: SE X-Spam-Score: 1.0 (+) X-Debbugs-Envelope-To: 63586 Cc: Eli Zaretskii <eliz@HIDDEN>, Stefan Monnier <monnier@HIDDEN>, 63586 <at> debbugs.gnu.org X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -0.0 (/) Hello Gabriele, > changing the value of the loop variable in the body of dotimes does = not seem to have any effect, where for versions <29.x it used to. Prior to Emacs 29, the `dotimes` macro expanded to different code = depending on whether lexical-binding was used or not, implicitly = permitting your practice of altering the loop counter in code using = dynamic binding. However, the macro was probably never intended to be used that way, and = your example does not work with lexical binding in any version as far as = I can tell. If you want to terminate your loop early, use catch/throw or a different = loop construct altogether: while, named-let, or cl-loop, just to name a = few. > changing the value of the loop variable from inside the loop > body is supported by any other language which I know about Then you should learn more languages! And you should use lexical-binding:t in all your elisp code. Always.
bug-gnu-emacs@HIDDEN:bug#63586; Package emacs.
Full text available.Received: (at submit) by debbugs.gnu.org; 19 May 2023 15:11:16 +0000 From debbugs-submit-bounces <at> debbugs.gnu.org Fri May 19 11:11:16 2023 Received: from localhost ([127.0.0.1]:57113 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1q01lD-0000Tq-Un for submit <at> debbugs.gnu.org; Fri, 19 May 2023 11:11:16 -0400 Received: from lists.gnu.org ([209.51.188.17]:45998) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <balducci@HIDDEN>) id 1q01lB-0000Ti-SF for submit <at> debbugs.gnu.org; Fri, 19 May 2023 11:11:14 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <balducci@HIDDEN>) id 1q01lB-0006Z8-JF for bug-gnu-emacs@HIDDEN; Fri, 19 May 2023 11:11:13 -0400 Received: from dschgrazlin2.univ.trieste.it ([140.105.55.81] helo=dschgrazlin2.units.it) by eggs.gnu.org with esmtp (Exim 4.90_1) (envelope-from <balducci@HIDDEN>) id 1q01l9-0003ZM-KD for bug-gnu-emacs@HIDDEN; Fri, 19 May 2023 11:11:13 -0400 Received: from dschgrazlin2.units.it (loopback [127.0.0.1]) by dschgrazlin2.units.it (8.17.1/8.17.1) with ESMTP id 34JFAihv004451 for <bug-gnu-emacs@HIDDEN>; Fri, 19 May 2023 17:10:44 +0200 To: bug-gnu-emacs@HIDDEN From: balducci@HIDDEN Subject: 29.x: dotimes (possible) problem X-Mailer: MH-E 8.6+git; nmh 1.8; Emacs 29.0.91 MIME-Version: 1.0 Content-Type: text/plain; charset="us-ascii" Content-ID: <4449.1684509068.1@HIDDEN> Date: Fri, 19 May 2023 17:10:44 +0200 Message-ID: <4450.1684509068@HIDDEN> X-Greylist: inspected by milter-greylist-4.6.4 (dschgrazlin2.units.it [0.0.0.0]); Fri, 19 May 2023 17:10:44 +0200 (CEST) for IP:'127.0.0.1' DOMAIN:'loopback' HELO:'dschgrazlin2.units.it' FROM:'balducci@HIDDEN' RCPT:'' X-Greylist: Sender IP whitelisted, not delayed by milter-greylist-4.6.4 (dschgrazlin2.units.it [0.0.0.0]); Fri, 19 May 2023 17:10:44 +0200 (CEST) Received-SPF: pass client-ip=140.105.55.81; envelope-from=balducci@HIDDEN; helo=dschgrazlin2.units.it X-Spam_score_int: -18 X-Spam_score: -1.9 X-Spam_bar: - X-Spam_report: (-1.9 / 5.0 requ) BAYES_00=-1.9, SPF_HELO_NONE=0.001, SPF_PASS=-0.001, T_SCC_BODY_TEXT_LINE=-0.01 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: -1.3 (-) X-Debbugs-Envelope-To: submit X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -2.3 (--) hello the dotimes macro behaves differently in 29.x with respect to previous versions Basically: changing the value of the loop variable in the body of dotimes does not seem to have any effect, where for versions <29.x it used to. Here is a minimal stretch of dummy code clarifying the problem I'm reporting. emacs-29.0.91 (or 29.0.90) ========================== (dotimes (ii 10) (insert (format "%2d " ii)) (when (= ii 4)(setq ii 11)) ) ==> 0 1 2 3 4 5 6 7 8 9 emacs-28.2 (or any version <29.x) ================================= (dotimes (ii 10) (insert (format "%2d " ii)) (when (= ii 4)(setq ii 11)) ) ==> 0 1 2 3 4 The ability to jump out of the loop by pushing the loop variable over the upper limit is something that I happen to use in my scripts, so 29.x breaks them somehow Of course, there are very many other equivalent ways to accomplish the same result, but I don't see why this one shouldn't be supported (any longer) Is the changed behavior intentional? Am I missing some blatant point here? AFAICS, changing the value of the loop variable from inside the loop body is supported by any other language which I know about thank you very much in advance for any hint/feedback ciao -gabriele
balducci@HIDDEN:bug-gnu-emacs@HIDDEN.
Full text available.bug-gnu-emacs@HIDDEN:bug#63586; Package emacs.
Full text available.
GNU bug tracking system
Copyright (C) 1999 Darren O. Benham,
1997 nCipher Corporation Ltd,
1994-97 Ian Jackson.