X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: jm@HIDDEN Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Fri, 28 Feb 2025 17:41:02 +0000 Resent-Message-ID: <handler.76650.B.174076444027071 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: report 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: 76650 <at> debbugs.gnu.org X-Debbugs-Original-To: bug-gnu-emacs@HIDDEN Received: via spool by submit <at> debbugs.gnu.org id=B.174076444027071 (code B ref -1); Fri, 28 Feb 2025 17:41:02 +0000 Received: (at submit) by debbugs.gnu.org; 28 Feb 2025 17:40:40 +0000 Received: from localhost ([127.0.0.1]:52231 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1to4Ln-00072R-14 for submit <at> debbugs.gnu.org; Fri, 28 Feb 2025 12:40:39 -0500 Received: from lists.gnu.org ([2001:470:142::17]:57710) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <jm@HIDDEN>) id 1to4Lj-00071X-Kh for submit <at> debbugs.gnu.org; Fri, 28 Feb 2025 12:40:36 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <jm@HIDDEN>) id 1to4Le-0001H5-2l for bug-gnu-emacs@HIDDEN; Fri, 28 Feb 2025 12:40:30 -0500 Received: from fout-b5-smtp.messagingengine.com ([202.12.124.148]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <jm@HIDDEN>) id 1to4Lc-0004OS-8Z for bug-gnu-emacs@HIDDEN; Fri, 28 Feb 2025 12:40:29 -0500 Received: from phl-compute-05.internal (phl-compute-05.phl.internal [10.202.2.45]) by mailfout.stl.internal (Postfix) with ESMTP id 23CB5114015C for <bug-gnu-emacs@HIDDEN>; Fri, 28 Feb 2025 12:40:25 -0500 (EST) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-05.internal (MEProxy); Fri, 28 Feb 2025 12:40:25 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pub.pink; h=cc :content-transfer-encoding:content-type:content-type:date:date :from:from:in-reply-to:message-id:mime-version:reply-to:subject :subject:to:to; s=fm1; t=1740764424; x=1740850824; bh=X8KOXXAlD7 nuz9sZZSVzPVYqXHm4XkysGOTle2UCCyQ=; b=hhraQ16Gnsrk/XNvPiHfCxeE4R i0fET4EYjajyvK6fYIBuLqkwPnPDuu9ADgWOAonpK2oXEP+FMoIUUuj2j+Sbpa7A k/PALGGEbJl3P+/JHHpjQhFSmnK4I/034Nlka5Pf8f1XCljQ+WLKwHZzSl4+7QU+ LB1iD8Txh00/VM3xVO7/g/WSgw5KyO0YHT+k2jCmKrI+CaviOQF4VO8Hxn+YLU+6 1eZryG7vsn46Xca6lP4djyNLsg5nyx7E7C7r4F/9WxcyHhWBeYVx1Eek9qPUUj/I DoUwnkbWkXy0P5rGlUgo0lQCvJRMqzxrrF+HHLnpWn0IiZCbtolOhzzB3P6A== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-transfer-encoding:content-type :content-type:date:date:feedback-id:feedback-id:from:from :in-reply-to:message-id:mime-version:reply-to:subject:subject:to :to:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t= 1740764424; x=1740850824; bh=X8KOXXAlD7nuz9sZZSVzPVYqXHm4XkysGOT le2UCCyQ=; b=MO9MgEiIit6/JoMMcGdB/34FH0j7wis0oYhhbyoT+i2O+S1sEPq CZNuV60f5/V4WjsCCOwkhR5GwepdSoqRyxWCPFlQ9JnBCLFR6Gy1AnZaxD34vovR bn0wiXZqMPySOkNE2UA9nwLW6QtV4xP3R+6QY8o7RC+rOk9/2bDBN6xOzphseFvb p+mLm6dT3xduB5suFLZgNtVzcALHrFiOCD1RO+VTSySTdimDcs/8JSlu3g04Yb++ Rp2P+k1uTBKzCB2Gpx3GavydEHcrqV6ee0clOMaUHZnjXXiBqvMgd0ChLlFP1/lE zduK5xBHpesZzOxrI3jiabvm1eX50Cphe6w== X-ME-Sender: <xms:CPXBZ86NURq3YmzciotYhv_iAHpvQtjFPsYOJ9y0Sf8vHW5Am8CEhg> <xme:CPXBZ96Q_h9T7ZE9cVBTb95VdPNWvbDmlVj0upzdRoDu5HlZrGyKn2UPmXBliP5i- 1dnKOawOdHyal35wMo> X-ME-Received: <xmr:CPXBZ7d6k12R4g3lxDo19PNKMYMvQE1kiD2PYBD1b-iiecHL6DGkWg> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdeluddtudcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecunecujfgurhephffvuf ffkfggtgfgsehtqhertddttdejnecuhfhrohhmpehjmhesphhusgdrphhinhhknecuggft rfgrthhtvghrnheptefgfefgfeeggeffffdvjeejffffffelgfeuhffgueeijefhteeihf ejteehfeeinecuffhomhgrihhnpehgihhtrdhonhgvnecuvehluhhsthgvrhfuihiivgep tdenucfrrghrrghmpehmrghilhhfrhhomhepjhhmsehpuhgsrdhpihhnkhdpnhgspghrtg hpthhtohepuddpmhhouggvpehsmhhtphhouhhtpdhrtghpthhtohepsghughdqghhnuhdq vghmrggtshesghhnuhdrohhrgh X-ME-Proxy: <xmx:CPXBZxIWo2_I5XlZ22VIMMGsa3OWXnF_k5tHRzu7KFwIvxaJ0-3ITg> <xmx:CPXBZwJWID9aiX6wSmtE38enGK30ZNnG_qgZlYmwRetn7n3SHMLLkw> <xmx:CPXBZywHyXTnQET_KUxT9kka9a1GZKov0H1GJ0f5t7ZMJrYOspKyqA> <xmx:CPXBZ0InN40l9D94DURalROZ_Ixg1cDLHaxtMqjaJJSGw8nO1Ms_xA> <xmx:CPXBZ6gRrCj6nhPeU29SxuYB_2ympheLJA1H5Evdf65QLGYcsPSYpDk-> Feedback-ID: i74194916:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA for <bug-gnu-emacs@HIDDEN>; Fri, 28 Feb 2025 12:40:24 -0500 (EST) From: jm@HIDDEN Date: Fri, 28 Feb 2025 11:40:18 -0600 Message-ID: <87mse6ufwd.fsf@HIDDEN> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Received-SPF: pass client-ip=202.12.124.148; envelope-from=jm@HIDDEN; helo=fout-b5-smtp.messagingengine.com X-Spam_score_int: -27 X-Spam_score: -2.8 X-Spam_bar: -- X-Spam_report: (-2.8 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_VALIDITY_RPBL_BLOCKED=0.001, RCVD_IN_VALIDITY_SAFE_BLOCKED=0.001, SPF_HELO_PASS=-0.001, SPF_PASS=-0.001 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: 0.7 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -0.3 (/) I=E2=80=99ve talked with Denis (the current maintainer) about integrating lua-mode into Emacs and they are in favor of it. If there is interest on the Emacs side I can send over the list of contributors for assignment verification. There are about a dozen authors with contributions over the exempted 15 lines and most of those I was able to find commits from in emacs.git. One sticky bit is that the initial commit contains contributions from unknown authors and I have not audited the code to see what is left in the current version but can start working on that if the decision is to include it in Emacs.
Content-Disposition: inline Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-Mailer: MIME-tools 5.505 (Entity 5.505) Content-Type: text/plain; charset=utf-8 X-Loop: help-debbugs@HIDDEN From: help-debbugs@HIDDEN (GNU bug Tracking System) To: jm@HIDDEN Subject: bug#76650: Acknowledgement (31.0.50; Add lua-mode to Emacs) Message-ID: <handler.76650.B.174076444027071.ack <at> debbugs.gnu.org> References: <87mse6ufwd.fsf@HIDDEN> X-Gnu-PR-Message: ack 76650 X-Gnu-PR-Package: emacs Reply-To: 76650 <at> debbugs.gnu.org Date: Fri, 28 Feb 2025 17:41:03 +0000 Thank you for filing a new bug report with debbugs.gnu.org. This is an automatically generated reply to let you know your message has been received. Your message is being forwarded to the package maintainers and other interested parties for their attention; they will reply in due course. Your message has been sent to the package maintainer(s): bug-gnu-emacs@HIDDEN If you wish to submit further information on this problem, please send it to 76650 <at> debbugs.gnu.org. Please do not send mail to help-debbugs@HIDDEN unless you wish to report a problem with the Bug-tracking system. --=20 76650: https://debbugs.gnu.org/cgi/bugreport.cgi?bug=3D76650 GNU Bug Tracking System Contact help-debbugs@HIDDEN with problems
Received: (at control) by debbugs.gnu.org; 1 Mar 2025 05:02:59 +0000 From debbugs-submit-bounces <at> debbugs.gnu.org Sat Mar 01 00:02:59 2025 Received: from localhost ([127.0.0.1]:58311 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1toF06-0006z2-VA for submit <at> debbugs.gnu.org; Sat, 01 Mar 2025 00:02:59 -0500 Received: from mail-ed1-x529.google.com ([2a00:1450:4864:20::529]:50556) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from <stefankangas@HIDDEN>) id 1toF04-0006yF-Ch for control <at> debbugs.gnu.org; Sat, 01 Mar 2025 00:02:56 -0500 Received: by mail-ed1-x529.google.com with SMTP id 4fb4d7f45d1cf-5e04861e7a6so4706399a12.1 for <control <at> debbugs.gnu.org>; Fri, 28 Feb 2025 21:02:56 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1740805370; x=1741410170; darn=debbugs.gnu.org; h=to:subject:message-id:date:mime-version:from:from:to:cc:subject :date:message-id:reply-to; bh=mynuUYCMjWr1caIabLEVYmuQK4sITOy/WezQyNZejOg=; b=T/5n0MjqRlIGTmPvy9hd0i+w9xvxob1Yo5xr2nLZbjHg7Cb/nsnlGjUYZjODGu2ML5 Adewm0E2tRY7XkxMQdzdtpSbxx2AN0GG3KzEEFFCU06r0l8HT+pxeNDvDxKBqwCG3gCw aqycRPOVBsw/uAVdANKqDUZPaiiTU4lAilr0r7BRD73wMVMoniZyKykzn3Ni/XVCxTME bdd6MIpF3w4JA7toRHI3s5kTlh0L7rKDkQovCOcCT0BvxOxDsxPLXSygKe1CH/UJLNMD Wa7ERF5urZyhOBKBFDGE4XAhXe1hP30awBiclR3smwJQP68hI2Ro+4AGvqWyEcsqlOwz ADCg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1740805370; x=1741410170; h=to:subject:message-id:date:mime-version:from:x-gm-message-state :from:to:cc:subject:date:message-id:reply-to; bh=mynuUYCMjWr1caIabLEVYmuQK4sITOy/WezQyNZejOg=; b=BsxrlO8QV4Xbf3LJxtocBCrltqGue7cuzv9bKjRD5ArBjtqnIPuQdS3+u5+TY31IfM bFxNUfYukiz2yi4Z+onZauMNSXjXzjWVHp8rK6fUVcfxgGsZZ739F1kzp5R288SpOT+7 4ciYres1sy5ThpvkAAgjDIxZHmGjzGLn5/Wly0RVkKawbOyXKsfllOToijd/nQ/+vorC 0IDeN1woh3WhBovU4SapnIzK9wNHXZhVsbi0t1lb7LrOrigmHq1bQl/ofMfx6zYb2kll HeZd4LbMDtBMad8d1hkuqR/AreFBh1AQGF/pz8UE6u0vfcf+3LngkhF4WndrwFiwbN1e HhDw== X-Gm-Message-State: AOJu0Yz1leGEN1kUdtbYaHznK7fqO93vnr75kCCyGTP03hpk1aRqJCWS JbY23Fa5z6hpeQjwBBvYf47saDLYSxJwYkMycWVeP9B7SHsKSuox981eLQtCR7GmVl9EyIOdnNy r1q0LZIYuA8VuPnBQ46U/BJLsWqTWHEjI8QE= X-Gm-Gg: ASbGncsROPg2wd2sB3KsGgIkpwh1o36RPvVXWuESueThKTJxOQkP1Ar8w9JPBAZtYwX vAoszVIQfqFgjKr1U2rM0sqYMruWhwbwRCKdzzR2DHcFROKhUR+VOVepI2cO5dSODbPGkj/TfXY IqjgC/c16KUy3od9x+JjtuG5vR0g== X-Google-Smtp-Source: AGHT+IGlV8VDD7Ag7jXG9KpOo1UdbWcLyyKB+WCuhnsgPcO33EycQdaMXUDmewf/VwWtg2OxzO705/bo1FmszlfjdQw= X-Received: by 2002:a05:6402:270d:b0:5e4:b66f:880b with SMTP id 4fb4d7f45d1cf-5e4d6adbd26mr5449892a12.6.1740805369900; Fri, 28 Feb 2025 21:02:49 -0800 (PST) Received: from 753933720722 named unknown by gmailapi.google.com with HTTPREST; Fri, 28 Feb 2025 21:02:49 -0800 From: Stefan Kangas <stefankangas@HIDDEN> MIME-Version: 1.0 Date: Fri, 28 Feb 2025 21:02:49 -0800 X-Gm-Features: AQ5f1JpKJcm7BQgDZ6colqHRGlt6JIbDiUGoLbgcbgls8gNDoH377-IBEpYbc5U Message-ID: <CADwFkmmEXF5G7XJNuQJyetEcqD98tcMkzS7NQH4=za-VuCea=Q@HIDDEN> Subject: control message for bug #76650 To: control <at> debbugs.gnu.org Content-Type: text/plain; charset="UTF-8" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: control X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) severity 76650 wishlist quit
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: Richard Stallman <rms@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Mon, 03 Mar 2025 04:46:02 +0000 Resent-Message-ID: <handler.76650.B76650.174097714923120 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: jm@HIDDEN Cc: 76650 <at> debbugs.gnu.org Reply-To: rms@HIDDEN Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.174097714923120 (code B ref 76650); Mon, 03 Mar 2025 04:46:02 +0000 Received: (at 76650) by debbugs.gnu.org; 3 Mar 2025 04:45:49 +0000 Received: from localhost ([127.0.0.1]:42543 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1toxgb-00060p-DJ for submit <at> debbugs.gnu.org; Sun, 02 Mar 2025 23:45:49 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:52586) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <rms@HIDDEN>) id 1toxgY-000605-DH for 76650 <at> debbugs.gnu.org; Sun, 02 Mar 2025 23:45:48 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <rms@HIDDEN>) id 1toxgS-0008Aq-O5; Sun, 02 Mar 2025 23:45:40 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=Date:References:Subject:In-Reply-To:To:From: mime-version; bh=idTAxP2UhnbOIetnrBhoUnguqC2xEuEnGwXBKn5KCB8=; b=ZOEMH7HVDZpt rOU3JA0X++F3UWLttZ82mDnFbXAVumu+Cm2DUmFoShCQLm9DIfksOLynSac9VmVbmSzkrq5zRg6YZ TW1bg2HJ50V8+TLQivOsPKM4ATg37xJz+RNgbHL4Gq7HnixBlx4moqXIGWR/g+aoHeWOV7d4KbH/L oyAaA7pDgIv1TUjhYGDSsuNah/kttJFHRPIQqMQPYHRb9IvtGMpzj3H2M7jBDl3+g5pQTb7HFQR33 1tSWVwGcegcY8gj4Ms/rZrxT1DpMA0zgzC88Bf14No3miBsdWqfR/H9+rLMJD85beUto4eTaUJdA/ 0LsIIlP1B+kHz+/OwNnRHw==; Received: from rms by fencepost.gnu.org with local (Exim 4.90_1) (envelope-from <rms@HIDDEN>) id 1toxgR-00034N-UH; Sun, 02 Mar 2025 23:45:40 -0500 Content-Type: text/plain; charset=Utf-8 From: Richard Stallman <rms@HIDDEN> In-Reply-To: <87mse6ufwd.fsf@HIDDEN> (jm@HIDDEN) References: <87mse6ufwd.fsf@HIDDEN> Message-Id: <E1toxgR-00034N-UH@HIDDEN> Date: Sun, 02 Mar 2025 23:45:39 -0500 X-Spam-Score: -2.3 (--) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -3.3 (---) [[[ To any NSA and FBI agents reading my email: please consider ]]] [[[ whether defending the US Constitution against all enemies, ]]] [[[ foreign or domestic, requires you to follow Snowden's example. ]]] > One sticky bit is that the initial commit contains contributions > from unknown authors If significant amounts of that remain, one option is to delete them and write something new to handle those points. If it is clear there is only one way to write a certain piece of code then it is ok to use. -- Dr Richard Stallman (https://stallman.org) Chief GNUisance of the GNU Project (https://gnu.org) Founder, Free Software Foundation (https://fsf.org) Internet Hall-of-Famer (https://internethalloffame.org)
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: Stefan Kangas <stefankangas@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Tue, 04 Mar 2025 02:33:02 +0000 Resent-Message-ID: <handler.76650.B76650.174105556218808 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: jm@HIDDEN Cc: Eli Zaretskii <eliz@HIDDEN>, Andrea Corallo <acorallo@HIDDEN>, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.174105556218808 (code B ref 76650); Tue, 04 Mar 2025 02:33:02 +0000 Received: (at 76650) by debbugs.gnu.org; 4 Mar 2025 02:32:42 +0000 Received: from localhost ([127.0.0.1]:53624 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpI5K-0004tG-D6 for submit <at> debbugs.gnu.org; Mon, 03 Mar 2025 21:32:42 -0500 Received: from mail-ed1-x52c.google.com ([2a00:1450:4864:20::52c]:44527) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from <stefankangas@HIDDEN>) id 1tpI5I-0004sw-0f for 76650 <at> debbugs.gnu.org; Mon, 03 Mar 2025 21:32:40 -0500 Received: by mail-ed1-x52c.google.com with SMTP id 4fb4d7f45d1cf-5e0813bd105so8188839a12.1 for <76650 <at> debbugs.gnu.org>; Mon, 03 Mar 2025 18:32:39 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1741055554; x=1741660354; darn=debbugs.gnu.org; h=content-transfer-encoding:cc:to:subject:message-id:date :mime-version:references:in-reply-to:from:from:to:cc:subject:date :message-id:reply-to; bh=1nbGN3m7hrueQFB0O230fbp3ZoMBt/84EoQAnduJvgM=; b=HBPGT7bXK6AAa5DcYIS4JaerG/4xufig/bk6hzjcLVRiJqpwUB0W3viWYHAeD8XhtL IqgUw1dSkM/kJHFlbcvb1ZPwiYTnQ/qKe9w0enum2LznownAssm+ojtorxDmwYsuMiGE byYyY2id6W0Oeb3ZgYESEmpH/jq7PrTS0LXC02iqpMj/ggdd1T1SAR3lP/798+ux7o7V azagfBWJ/fUEH7bPybNc9lyd5952AeiFMZMaMvwerV0UdfSnQ+ndCthDCn+h81AkY9Qy a4e0Yitx2MMqVY/8BfJ98CH1FYNujRyNn4OPQp8YXUSkhmxuSy46WxTKUHimXOZAFOT7 iAEg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1741055554; x=1741660354; h=content-transfer-encoding:cc:to:subject:message-id:date :mime-version:references:in-reply-to:from:x-gm-message-state:from:to :cc:subject:date:message-id:reply-to; bh=1nbGN3m7hrueQFB0O230fbp3ZoMBt/84EoQAnduJvgM=; b=vqqFqzMCE8NqQ5GtWkVMJyFvXkEli5Ha5OszJ/aPMmkcNxdSYBY4lLolfMj0hfGEDi kmS/j8kPjJQEhZlnJtFE1/6r21IKmKmOp2XyVKbfzMX5P5Ml8oy2jYNgzT5bKuTWdJUW fzGYI/5JZcwzlps9WVxeps/WtO1HGIMbeN6z/XDKiM/UOBfQdnSI5+YvLWPrBzxSpS5g WnYzCixU0Q6PaTWLfKdAh1frkeySBsv5AC7xEK0NJf1/bsNvw0NDuxOvkuUjPMIYoT2g U5kZ12lw0aqMNwIpmbfhbouy8RuYmVYs7UptDG83Ap2LUj6GuEzcUpza5mGqcy9fmhFl B9VA== X-Gm-Message-State: AOJu0Yx4G0Xftpeqf8v65h89p/0xkHjqNFR+z56x6neY5x9Td14LOaPB IXoWzgeUuRAcrTuvwIl9WUO5ISPUXgwg8cXug/3EHwBpEZx5emAlogyq3iwKPIjD1GtRHbLRyfo P5GaVIEGrLX00F3LodViO99dvD/zE3lMWILg= X-Gm-Gg: ASbGncvdHPY+4vQo0D+T+EK+R0hYbDvMwHg1VKK6r/ZZ5B32fpTchVWOF0Vle+OVo2D 7CGV7nUgz0Mb2vHTPOILEpNkYos5cVEAmEq3jzhX7/4vm9anj5iP4kkupk9E6WMeX5//lfmk51m W4+lv8L//ng0oA4UBoqhlEz0pVT44= X-Google-Smtp-Source: AGHT+IFo/EmTIalhVGSbO7oxxxHz/N/Xyfu4VjRQGhJ7PZTj2ERLjCSibbMLKaMpBhunlnmTmEotmNjY8OOa1M++ycc= X-Received: by 2002:a05:6402:348a:b0:5dc:929a:a726 with SMTP id 4fb4d7f45d1cf-5e4d6b70f43mr15867611a12.26.1741055553796; Mon, 03 Mar 2025 18:32:33 -0800 (PST) Received: from 753933720722 named unknown by gmailapi.google.com with HTTPREST; Mon, 3 Mar 2025 18:32:32 -0800 From: Stefan Kangas <stefankangas@HIDDEN> In-Reply-To: <87mse6ufwd.fsf@HIDDEN> References: <87mse6ufwd.fsf@HIDDEN> MIME-Version: 1.0 Date: Mon, 3 Mar 2025 18:32:32 -0800 X-Gm-Features: AQ5f1JpMR5Y-obtEZMOu37rzKJjZdPKHcogSFkRHnXKJlktZOXKM_PYfM0l4T2Y Message-ID: <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Spam-Score: 0.0 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) jm@HIDDEN writes: > I=E2=80=99ve talked with Denis (the current maintainer) about integrating > lua-mode into Emacs and they are in favor of it. If there is > interest on the Emacs side I can send over the list of > contributors for assignment verification. There are about a dozen > authors with contributions over the exempted 15 lines and most of > those I was able to find commits from in emacs.git. Sounds like a good plan, thank you. LUA is quite popular, so I think it would be important to have built-in support for it, also it would help us develop lua-ts-mode. I don't know if Eli or Andrea have any further comments, but I'd say go for it.
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: Eli Zaretskii <eliz@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Tue, 04 Mar 2025 14:21:01 +0000 Resent-Message-ID: <handler.76650.B76650.174109804223049 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Stefan Kangas <stefankangas@HIDDEN> Cc: acorallo@HIDDEN, jm@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.174109804223049 (code B ref 76650); Tue, 04 Mar 2025 14:21:01 +0000 Received: (at 76650) by debbugs.gnu.org; 4 Mar 2025 14:20:42 +0000 Received: from localhost ([127.0.0.1]:56533 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpT8T-0005zh-HW for submit <at> debbugs.gnu.org; Tue, 04 Mar 2025 09:20:41 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:54348) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <eliz@HIDDEN>) id 1tpT8O-0005zL-L0 for 76650 <at> debbugs.gnu.org; Tue, 04 Mar 2025 09:20:39 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <eliz@HIDDEN>) id 1tpT8I-0003o2-GJ; Tue, 04 Mar 2025 09:20:30 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=eyHug7s0yNlnZAxe9Pl1sRjU5zZvQZtm80i4roIQCLo=; b=S0s9W7fDxwOTmZcFNvuj GKCQgPlvPObXVRGUwTAoqbrHN9RX3uhJZhretpimEhw9ErPxegojsM5DkfY8FLU5XmJ7RxC+mqGUx DuWWehFDPCNcAEXYerNarBvHIkUQKr4vnUEmUrOPDmWz2HfpFRSrzTTiTLRPaBbrFGOPf9sJa9yYV FvWV7cVsb10DBfdee8yTVT+5U0R9SJP6D3MlnxLQ3HVOivsJ/uyqceZ5eJ7AZdQwcR0JtbfTERewO SZsaCU5Wz/cfm81Mn3CF1GpelQN+yKZVSNHBh/X4dfvZgj5RgiwRT7Y+bYBk9drUnqczJ+lAyRj0z /mKPQgHgFnsm7Q==; Date: Tue, 04 Mar 2025 16:20:25 +0200 Message-Id: <86a5a0khcm.fsf@HIDDEN> From: Eli Zaretskii <eliz@HIDDEN> In-Reply-To: <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> (message from Stefan Kangas on Mon, 3 Mar 2025 18:32:32 -0800) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -3.3 (---) > From: Stefan Kangas <stefankangas@HIDDEN> > Date: Mon, 3 Mar 2025 18:32:32 -0800 > Cc: 76650 <at> debbugs.gnu.org, Eli Zaretskii <eliz@HIDDEN>, Andrea Corallo <acorallo@HIDDEN> > > jm@HIDDEN writes: > > > I’ve talked with Denis (the current maintainer) about integrating > > lua-mode into Emacs and they are in favor of it. If there is > > interest on the Emacs side I can send over the list of > > contributors for assignment verification. There are about a dozen > > authors with contributions over the exempted 15 lines and most of > > those I was able to find commits from in emacs.git. > > Sounds like a good plan, thank you. LUA is quite popular, so I think it > would be important to have built-in support for it, also it would help > us develop lua-ts-mode. > > I don't know if Eli or Andrea have any further comments, but I'd say go > for it. No objections here, of course.
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: john muhl <jm@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Tue, 04 Mar 2025 18:54:02 +0000 Resent-Message-ID: <handler.76650.B76650.174111443627110 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Stefan Kangas <stefankangas@HIDDEN> Cc: eliz@HIDDEN, acorallo@HIDDEN, 76650 <at> debbugs.gnu.org X-Debbugs-Original-Cc: Eli Zaretskii <eliz@HIDDEN>, Andrea Corallo <acorallo@HIDDEN>, bug-gnu-emacs@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.174111443627110 (code B ref 76650); Tue, 04 Mar 2025 18:54:02 +0000 Received: (at 76650) by debbugs.gnu.org; 4 Mar 2025 18:53:56 +0000 Received: from localhost ([127.0.0.1]:60939 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpXOt-00073A-Mk for submit <at> debbugs.gnu.org; Tue, 04 Mar 2025 13:53:55 -0500 Received: from fhigh-b1-smtp.messagingengine.com ([202.12.124.152]:44877) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <jm@HIDDEN>) id 1tpXOq-00072v-Fq for 76650 <at> debbugs.gnu.org; Tue, 04 Mar 2025 13:53:53 -0500 Received: from phl-compute-04.internal (phl-compute-04.phl.internal [10.202.2.44]) by mailfhigh.stl.internal (Postfix) with ESMTP id 4C8B62540314; Tue, 4 Mar 2025 13:53:46 -0500 (EST) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-04.internal (MEProxy); Tue, 04 Mar 2025 13:53:46 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pub.pink; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1741114426; x=1741200826; bh=9XV/SoHDIISB8ITgJSIthEmLW8MZRYXbv/qrpbx0XJY=; b= CFNmsJAHYnw6u5z25RmhVfzL7LuNt1Udap5Z1EMAgdWLDfNv0OteWoZeF9H2bKKi 7wrxOvod6GpSvNiKLc0Ht7ypqwOeE1pImBY3pGdHdIQRx0yxTqNtPLzvnHTBt4rH /D/Im68VNUXTaf35Zfsu3CYq5nl2M3D22+Cb1OMlj8F9tfFAf3L7f0ZG7PXfCBpQ Y2wnfaiNft2szRi9VmSaFiuyc1YuKyk9+qR9Beuljje6AtBYkwmUJpXy74HZlz0P PNzIRHlQkPfTgZ/AJ1Iq7N4VsYdkHYrioHIo/migj9gmUfi/Ll9SCypko2ZVTsaE UwKelD7a6spqJhq9EINjIQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1741114426; x= 1741200826; bh=9XV/SoHDIISB8ITgJSIthEmLW8MZRYXbv/qrpbx0XJY=; b=R 6KNyewRBHJHOXjBvkQpk5zStlHvA22U0YMpOR4UruCPO7AbnceGg6yUZbxbkGXo2 mKISgD9GW8hx6oqiX9X0M17gIi6et94/UK3c8PwePPZV9mexvUv+zKjggv+UnjdQ 9olya6kZJ2UwQ70TnnTSyo/sLHVauhkDsm6OpSfX1VehIivItCAe3O0rVFYcZG/M JPssebYVOnTLxhd4c10CVXqRSZ3IYAxTyIVLQaAcuiyJDJL8DpBf0Pf7xpxKjANE ApLEpP2nC9SWTjgmV5bHyPnW7EGB5j5gx8RH1ru7Zufxo5CBBXSiQ1m1yhjKCqa5 MYadbkBvdp8d2UXvcQLaA== X-ME-Sender: <xms:OUzHZ5gu0w4b-xZJdQrYa5pr4TyZDg_urkobWkl0sTULeSdx2Y-e1A> <xme:OUzHZ-CC3RdZP-JBXf2EOd0GjE5qff8vdKmKqBB1ddZIO552INHxCtcAl8U9UN_k4 HaGztMJFADSUexPJ-A> X-ME-Received: <xmr:OUzHZ5FRxgr4_ZDzn-15sT3qlwXdRqMcbRgDQXvKJUSdDaPDmCybig> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutddvkeduucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhepfhgfhffvvefuffgjkfggtgfgsehtqhertddt reejnecuhfhrohhmpehjohhhnhcumhhuhhhluceojhhmsehpuhgsrdhpihhnkheqnecugg ftrfgrthhtvghrnhepieeuudegtdevheejheduueeiuddukeffkedvkeekfefhveegtedv udegffeuleehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrh homhepjhhmsehpuhgsrdhpihhnkhdpnhgspghrtghpthhtohephedpmhhouggvpehsmhht phhouhhtpdhrtghpthhtohepsghughdqghhnuhdqvghmrggtshesghhnuhdrohhrghdprh gtphhtthhopeejieeihedtseguvggssghughhsrdhgnhhurdhorhhgpdhrtghpthhtohep rggtohhrrghllhhosehgnhhurdhorhhgpdhrtghpthhtohepvghlihiisehgnhhurdhorh hgpdhrtghpthhtohepshhtvghfrghnkhgrnhhgrghssehgmhgrihhlrdgtohhm X-ME-Proxy: <xmx:OUzHZ-RsSPjD1gdyxFxz40wGzp32E7cYmcoALI0VIt-nMytcf-s-iw> <xmx:OUzHZ2z5Hh-_es5zPANHGSV0AwpSg0FW8fdZY6o3LrcAM8L_SKq_Iw> <xmx:OUzHZ07XvSyh454j2AFNNH-eFmJfvEGraFXdvENAU7AQk2spQX6o_g> <xmx:OUzHZ7xRyi5eYlAAPnR3rG_Yg7HT76-1QJRcicxJDUiqWQIhX3XPog> <xmx:OkzHZ9qIzQmBx1Q87mcAO9A-jFcwr1Gsyz0oriwfe4VFsckdlU9hhqJ-> Feedback-ID: i74194916:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Tue, 4 Mar 2025 13:53:44 -0500 (EST) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> User-agent: mu4e 1.10.8; emacs 31.0.50 From: john muhl <jm@HIDDEN> Date: Tue, 04 Mar 2025 12:50:03 -0600 In-reply-to: <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> Message-ID: <87frjs6314.fsf@HIDDEN> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.7 (-) Stefan Kangas <stefankangas@HIDDEN> writes: > jm@HIDDEN writes: > >> I=E2=80=99ve talked with Denis (the current maintainer) about integrating >> lua-mode into Emacs and they are in favor of it. If there is >> interest on the Emacs side I can send over the list of >> contributors for assignment verification. There are about a dozen >> authors with contributions over the exempted 15 lines and most of >> those I was able to find commits from in emacs.git. > > Sounds like a good plan, thank you. LUA is quite popular, so I think it > would be important to have built-in support for it, also it would help > us develop lua-ts-mode. > > I don't know if Eli or Andrea have any further comments, but I'd say go > for it. Should I send the list of contributors to anyone in particular to check on assignment status or just post them here? Should I include email addresses in the list? Thanks.
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: john muhl <jm@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Tue, 04 Mar 2025 18:55:02 +0000 Resent-Message-ID: <handler.76650.B.174111445127169 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Stefan Kangas <stefankangas@HIDDEN> Cc: eliz@HIDDEN, acorallo@HIDDEN, 76650 <at> debbugs.gnu.org X-Debbugs-Original-Cc: Eli Zaretskii <eliz@HIDDEN>, Andrea Corallo <acorallo@HIDDEN>, bug-gnu-emacs@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by submit <at> debbugs.gnu.org id=B.174111445127169 (code B ref -1); Tue, 04 Mar 2025 18:55:02 +0000 Received: (at submit) by debbugs.gnu.org; 4 Mar 2025 18:54:11 +0000 Received: from localhost ([127.0.0.1]:60944 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpXP9-000748-7v for submit <at> debbugs.gnu.org; Tue, 04 Mar 2025 13:54:11 -0500 Received: from lists.gnu.org ([2001:470:142::17]:53880) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <jm@HIDDEN>) id 1tpXP2-00073B-4C for submit <at> debbugs.gnu.org; Tue, 04 Mar 2025 13:54:08 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <jm@HIDDEN>) id 1tpXOp-0007wk-La for bug-gnu-emacs@HIDDEN; Tue, 04 Mar 2025 13:53:53 -0500 Received: from fhigh-b1-smtp.messagingengine.com ([202.12.124.152]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <jm@HIDDEN>) id 1tpXOn-0001Ug-Kc; Tue, 04 Mar 2025 13:53:51 -0500 Received: from phl-compute-04.internal (phl-compute-04.phl.internal [10.202.2.44]) by mailfhigh.stl.internal (Postfix) with ESMTP id 4C8B62540314; Tue, 4 Mar 2025 13:53:46 -0500 (EST) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-04.internal (MEProxy); Tue, 04 Mar 2025 13:53:46 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pub.pink; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1741114426; x=1741200826; bh=9XV/SoHDIISB8ITgJSIthEmLW8MZRYXbv/qrpbx0XJY=; b= CFNmsJAHYnw6u5z25RmhVfzL7LuNt1Udap5Z1EMAgdWLDfNv0OteWoZeF9H2bKKi 7wrxOvod6GpSvNiKLc0Ht7ypqwOeE1pImBY3pGdHdIQRx0yxTqNtPLzvnHTBt4rH /D/Im68VNUXTaf35Zfsu3CYq5nl2M3D22+Cb1OMlj8F9tfFAf3L7f0ZG7PXfCBpQ Y2wnfaiNft2szRi9VmSaFiuyc1YuKyk9+qR9Beuljje6AtBYkwmUJpXy74HZlz0P PNzIRHlQkPfTgZ/AJ1Iq7N4VsYdkHYrioHIo/migj9gmUfi/Ll9SCypko2ZVTsaE UwKelD7a6spqJhq9EINjIQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1741114426; x= 1741200826; bh=9XV/SoHDIISB8ITgJSIthEmLW8MZRYXbv/qrpbx0XJY=; b=R 6KNyewRBHJHOXjBvkQpk5zStlHvA22U0YMpOR4UruCPO7AbnceGg6yUZbxbkGXo2 mKISgD9GW8hx6oqiX9X0M17gIi6et94/UK3c8PwePPZV9mexvUv+zKjggv+UnjdQ 9olya6kZJ2UwQ70TnnTSyo/sLHVauhkDsm6OpSfX1VehIivItCAe3O0rVFYcZG/M JPssebYVOnTLxhd4c10CVXqRSZ3IYAxTyIVLQaAcuiyJDJL8DpBf0Pf7xpxKjANE ApLEpP2nC9SWTjgmV5bHyPnW7EGB5j5gx8RH1ru7Zufxo5CBBXSiQ1m1yhjKCqa5 MYadbkBvdp8d2UXvcQLaA== X-ME-Sender: <xms:OUzHZ5gu0w4b-xZJdQrYa5pr4TyZDg_urkobWkl0sTULeSdx2Y-e1A> <xme:OUzHZ-CC3RdZP-JBXf2EOd0GjE5qff8vdKmKqBB1ddZIO552INHxCtcAl8U9UN_k4 HaGztMJFADSUexPJ-A> X-ME-Received: <xmr:OUzHZ5FRxgr4_ZDzn-15sT3qlwXdRqMcbRgDQXvKJUSdDaPDmCybig> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutddvkeduucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhepfhgfhffvvefuffgjkfggtgfgsehtqhertddt reejnecuhfhrohhmpehjohhhnhcumhhuhhhluceojhhmsehpuhgsrdhpihhnkheqnecugg ftrfgrthhtvghrnhepieeuudegtdevheejheduueeiuddukeffkedvkeekfefhveegtedv udegffeuleehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrh homhepjhhmsehpuhgsrdhpihhnkhdpnhgspghrtghpthhtohephedpmhhouggvpehsmhht phhouhhtpdhrtghpthhtohepsghughdqghhnuhdqvghmrggtshesghhnuhdrohhrghdprh gtphhtthhopeejieeihedtseguvggssghughhsrdhgnhhurdhorhhgpdhrtghpthhtohep rggtohhrrghllhhosehgnhhurdhorhhgpdhrtghpthhtohepvghlihiisehgnhhurdhorh hgpdhrtghpthhtohepshhtvghfrghnkhgrnhhgrghssehgmhgrihhlrdgtohhm X-ME-Proxy: <xmx:OUzHZ-RsSPjD1gdyxFxz40wGzp32E7cYmcoALI0VIt-nMytcf-s-iw> <xmx:OUzHZ2z5Hh-_es5zPANHGSV0AwpSg0FW8fdZY6o3LrcAM8L_SKq_Iw> <xmx:OUzHZ07XvSyh454j2AFNNH-eFmJfvEGraFXdvENAU7AQk2spQX6o_g> <xmx:OUzHZ7xRyi5eYlAAPnR3rG_Yg7HT76-1QJRcicxJDUiqWQIhX3XPog> <xmx:OkzHZ9qIzQmBx1Q87mcAO9A-jFcwr1Gsyz0oriwfe4VFsckdlU9hhqJ-> Feedback-ID: i74194916:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Tue, 4 Mar 2025 13:53:44 -0500 (EST) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> User-agent: mu4e 1.10.8; emacs 31.0.50 From: john muhl <jm@HIDDEN> Date: Tue, 04 Mar 2025 12:50:03 -0600 In-reply-to: <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> Message-ID: <87frjs6314.fsf@HIDDEN> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Received-SPF: pass client-ip=202.12.124.152; envelope-from=jm@HIDDEN; helo=fhigh-b1-smtp.messagingengine.com X-Spam_score_int: -27 X-Spam_score: -2.8 X-Spam_bar: -- X-Spam_report: (-2.8 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_VALIDITY_RPBL_BLOCKED=0.001, RCVD_IN_VALIDITY_SAFE_BLOCKED=0.001, SPF_HELO_PASS=-0.001, SPF_PASS=-0.001 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: 0.7 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -0.3 (/) Stefan Kangas <stefankangas@HIDDEN> writes: > jm@HIDDEN writes: > >> I=E2=80=99ve talked with Denis (the current maintainer) about integrating >> lua-mode into Emacs and they are in favor of it. If there is >> interest on the Emacs side I can send over the list of >> contributors for assignment verification. There are about a dozen >> authors with contributions over the exempted 15 lines and most of >> those I was able to find commits from in emacs.git. > > Sounds like a good plan, thank you. LUA is quite popular, so I think it > would be important to have built-in support for it, also it would help > us develop lua-ts-mode. > > I don't know if Eli or Andrea have any further comments, but I'd say go > for it. Should I send the list of contributors to anyone in particular to check on assignment status or just post them here? Should I include email addresses in the list? Thanks.
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: Eli Zaretskii <eliz@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Tue, 04 Mar 2025 19:39:02 +0000 Resent-Message-ID: <handler.76650.B.17411171393885 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: john muhl <jm@HIDDEN> Cc: 76650 <at> debbugs.gnu.org, acorallo@HIDDEN, stefankangas@HIDDEN X-Debbugs-Original-Cc: bug-gnu-emacs@HIDDEN, acorallo@HIDDEN, stefankangas@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by submit <at> debbugs.gnu.org id=B.17411171393885 (code B ref -1); Tue, 04 Mar 2025 19:39:02 +0000 Received: (at submit) by debbugs.gnu.org; 4 Mar 2025 19:38:59 +0000 Received: from localhost ([127.0.0.1]:32980 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpY6U-00010a-Pn for submit <at> debbugs.gnu.org; Tue, 04 Mar 2025 14:38:59 -0500 Received: from lists.gnu.org ([2001:470:142::17]:32894) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <eliz@HIDDEN>) id 1tpY6L-0000zl-W8 for submit <at> debbugs.gnu.org; Tue, 04 Mar 2025 14:38:50 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <eliz@HIDDEN>) id 1tpY6B-0004De-50 for bug-gnu-emacs@HIDDEN; Tue, 04 Mar 2025 14:38:42 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <eliz@HIDDEN>) id 1tpY68-00024P-Sy; Tue, 04 Mar 2025 14:38:37 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=VhlMARDEYURTfOaEdvDvzsWao9p7/YmYvei9CVqWXiA=; b=dCbYEbWB0NqPjHETtKBL gNPUGOu3OZKzzgivVkU1XIgVNzT48DqMK0phCl81tzxbFqNGFBtDsdBIJ8sKdLZalEE7+1KZwuXE+ UaZ0AAMhPeibgxaq3RwaRczvxEHY9DLLMNoo7xuE0kjVV4NtTFZSkvlq+tgG//ISoqDv7M8LTPcl0 del3v+mjg6/cpacQh7l2F20PSCpMGlYNM2EfqPLcrsrxrrAD+H1D/O4S3X6+gHk5qhjXQPrAE3dCC 8/av1eqPZVWbBMavy5yd19p5JUrZQg0It2IOr41C6yDMQBQaqt73atItishMcgcO2M8w++OmKrPee yAiYfdlzzD9Y3Q==; Date: Tue, 04 Mar 2025 21:38:32 +0200 Message-Id: <86senspow7.fsf@HIDDEN> From: Eli Zaretskii <eliz@HIDDEN> In-Reply-To: <87frjs6314.fsf@HIDDEN> (message from john muhl on Tue, 04 Mar 2025 12:50:03 -0600) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -0.0 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) > From: john muhl <jm@HIDDEN> > Cc: Eli Zaretskii <eliz@HIDDEN>, Andrea Corallo <acorallo@HIDDEN>, > 76650 <at> debbugs.gnu.org, bug-gnu-emacs@HIDDEN > Date: Tue, 04 Mar 2025 12:50:03 -0600 > > > Stefan Kangas <stefankangas@HIDDEN> writes: > > > jm@HIDDEN writes: > > > >> I’ve talked with Denis (the current maintainer) about integrating > >> lua-mode into Emacs and they are in favor of it. If there is > >> interest on the Emacs side I can send over the list of > >> contributors for assignment verification. There are about a dozen > >> authors with contributions over the exempted 15 lines and most of > >> those I was able to find commits from in emacs.git. > > > > Sounds like a good plan, thank you. LUA is quite popular, so I think it > > would be important to have built-in support for it, also it would help > > us develop lua-ts-mode. > > > > I don't know if Eli or Andrea have any further comments, but I'd say go > > for it. > > Should I send the list of contributors to anyone in particular to > check on assignment status or just post them here? Should I > include email addresses in the list? Please post the list here, including email addresses. Thanks.
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: Eli Zaretskii <eliz@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Tue, 04 Mar 2025 19:39:03 +0000 Resent-Message-ID: <handler.76650.B76650.17411171273849 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: john muhl <jm@HIDDEN> Cc: 76650 <at> debbugs.gnu.org, acorallo@HIDDEN, stefankangas@HIDDEN X-Debbugs-Original-Cc: bug-gnu-emacs@HIDDEN, acorallo@HIDDEN, stefankangas@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.17411171273849 (code B ref 76650); Tue, 04 Mar 2025 19:39:03 +0000 Received: (at 76650) by debbugs.gnu.org; 4 Mar 2025 19:38:47 +0000 Received: from localhost ([127.0.0.1]:32976 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpY6J-000101-92 for submit <at> debbugs.gnu.org; Tue, 04 Mar 2025 14:38:47 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:34214) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <eliz@HIDDEN>) id 1tpY6G-0000zd-6Y for 76650 <at> debbugs.gnu.org; Tue, 04 Mar 2025 14:38:44 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <eliz@HIDDEN>) id 1tpY68-00024P-Sy; Tue, 04 Mar 2025 14:38:37 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=VhlMARDEYURTfOaEdvDvzsWao9p7/YmYvei9CVqWXiA=; b=dCbYEbWB0NqPjHETtKBL gNPUGOu3OZKzzgivVkU1XIgVNzT48DqMK0phCl81tzxbFqNGFBtDsdBIJ8sKdLZalEE7+1KZwuXE+ UaZ0AAMhPeibgxaq3RwaRczvxEHY9DLLMNoo7xuE0kjVV4NtTFZSkvlq+tgG//ISoqDv7M8LTPcl0 del3v+mjg6/cpacQh7l2F20PSCpMGlYNM2EfqPLcrsrxrrAD+H1D/O4S3X6+gHk5qhjXQPrAE3dCC 8/av1eqPZVWbBMavy5yd19p5JUrZQg0It2IOr41C6yDMQBQaqt73atItishMcgcO2M8w++OmKrPee yAiYfdlzzD9Y3Q==; Date: Tue, 04 Mar 2025 21:38:32 +0200 Message-Id: <86senspow7.fsf@HIDDEN> From: Eli Zaretskii <eliz@HIDDEN> In-Reply-To: <87frjs6314.fsf@HIDDEN> (message from john muhl on Tue, 04 Mar 2025 12:50:03 -0600) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -3.3 (---) > From: john muhl <jm@HIDDEN> > Cc: Eli Zaretskii <eliz@HIDDEN>, Andrea Corallo <acorallo@HIDDEN>, > 76650 <at> debbugs.gnu.org, bug-gnu-emacs@HIDDEN > Date: Tue, 04 Mar 2025 12:50:03 -0600 > > > Stefan Kangas <stefankangas@HIDDEN> writes: > > > jm@HIDDEN writes: > > > >> I’ve talked with Denis (the current maintainer) about integrating > >> lua-mode into Emacs and they are in favor of it. If there is > >> interest on the Emacs side I can send over the list of > >> contributors for assignment verification. There are about a dozen > >> authors with contributions over the exempted 15 lines and most of > >> those I was able to find commits from in emacs.git. > > > > Sounds like a good plan, thank you. LUA is quite popular, so I think it > > would be important to have built-in support for it, also it would help > > us develop lua-ts-mode. > > > > I don't know if Eli or Andrea have any further comments, but I'd say go > > for it. > > Should I send the list of contributors to anyone in particular to > check on assignment status or just post them here? Should I > include email addresses in the list? Please post the list here, including email addresses. Thanks.
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: john muhl <jm@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Tue, 04 Mar 2025 20:33:01 +0000 Resent-Message-ID: <handler.76650.B.174112036326304 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Eli Zaretskii <eliz@HIDDEN> Cc: 76650 <at> debbugs.gnu.org, acorallo@HIDDEN, stefankangas@HIDDEN X-Debbugs-Original-Cc: bug-gnu-emacs@HIDDEN, acorallo@HIDDEN, stefankangas@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by submit <at> debbugs.gnu.org id=B.174112036326304 (code B ref -1); Tue, 04 Mar 2025 20:33:01 +0000 Received: (at submit) by debbugs.gnu.org; 4 Mar 2025 20:32:43 +0000 Received: from localhost ([127.0.0.1]:33135 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpYwP-0006pz-Mr for submit <at> debbugs.gnu.org; Tue, 04 Mar 2025 15:32:43 -0500 Received: from lists.gnu.org ([2001:470:142::17]:46416) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <jm@HIDDEN>) id 1tpYwG-0006pD-Hs for submit <at> debbugs.gnu.org; Tue, 04 Mar 2025 15:32:32 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <jm@HIDDEN>) id 1tpYw9-0006cA-3G for bug-gnu-emacs@HIDDEN; Tue, 04 Mar 2025 15:32:21 -0500 Received: from fhigh-b2-smtp.messagingengine.com ([202.12.124.153]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <jm@HIDDEN>) id 1tpYw6-0006Bn-JQ; Tue, 04 Mar 2025 15:32:20 -0500 Received: from phl-compute-05.internal (phl-compute-05.phl.internal [10.202.2.45]) by mailfhigh.stl.internal (Postfix) with ESMTP id A764A25400D7; Tue, 4 Mar 2025 15:32:15 -0500 (EST) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-05.internal (MEProxy); Tue, 04 Mar 2025 15:32:15 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pub.pink; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1741120335; x=1741206735; bh=pMsuYafnhrunBbJxK3CCYRdY1H5tmq8HY0tqrQ8BE2Q=; b= wwveXS5QpzrJ521q79+byeCKwGu+nIcXZxVEaYw6ZguNHM2rwcUymf9hhGRFycRx foY4h7dDzeiCW49R1B3N+CkcmFi9ePsZOdnYZmDFu48NnHB4iutqTUmwBsrEwcdg CUXN4Ks1Yk0RKj6dg2ccl4HlOMF3fIVbKVhTXwdQaotREwOtJ2mGNe4a5zd711zx DNQT7+zIsACn0OrFObrjbPsogMQTGsVMBAgUv3xRZ/dIWbZFZLC0oal186qPmBQM uVYO4s5NlNHk1zEFak1pfm7I8UJpfmFlIbDOKOQAnX8aofssuQhCLDnKbSUaMH/R 7IldsUQQA2B1z+lz6uqbpg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1741120335; x= 1741206735; bh=pMsuYafnhrunBbJxK3CCYRdY1H5tmq8HY0tqrQ8BE2Q=; b=n 0WAlBI/MexT12ADabuxvWHpcUyEIyOdQy2fsEN4HCKOYp2Crk2dEeb59m2JAOpem U+szIhigI7bscwyGXvU1coPHfQvOOtGtLO2fOrS22LQATsd2jtlVu3nveHXm5Qlt 82p9M2B5Gp3wsvhcdAWeCr4gF/9Wtj8iT1UCUOx1OafjKT2ACcQ323+cTz5FMIvh RIDhn0ecSF367+HrCOGLoNmJCPHkgHyvp1HBJ8JoPUwU/qj3KsHHh06lNYBpyVf+ AoKBUAKa27jXYsLRlHiq1ylnDtim5dlgKm827h/Zqn7aOfRuY8b9tUm09TVRmyO+ Y4KDBzUB4v97x+q6pp7+w== X-ME-Sender: <xms:T2PHZ7Z-IJzN7zYbXNB9Lu7P2xsNKsXnRnkv2Vts6E9F29K3FNMn8w> <xme:T2PHZ6aTa5dlEHsg8SoBSmYlJhNKKgifDSdIIHBxOib3BzmCqG08_LUaFK0z-3U26 q-oCKD3AkvlkpV_1wc> X-ME-Received: <xmr:T2PHZ99Z3Scl810YVqLuSIPGNwfLAJrzOAeiJrWAHWFtLerrA2e8Cg> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutdeftdduucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhepfhgfhffvvefuffgjkfggtgfgsehtqhertddt reejnecuhfhrohhmpehjohhhnhcumhhuhhhluceojhhmsehpuhgsrdhpihhnkheqnecugg ftrfgrthhtvghrnhepieeuudegtdevheejheduueeiuddukeffkedvkeekfefhveegtedv udegffeuleehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrh homhepjhhmsehpuhgsrdhpihhnkhdpnhgspghrtghpthhtohephedpmhhouggvpehsmhht phhouhhtpdhrtghpthhtohepsghughdqghhnuhdqvghmrggtshesghhnuhdrohhrghdprh gtphhtthhopeejieeihedtseguvggssghughhsrdhgnhhurdhorhhgpdhrtghpthhtohep rggtohhrrghllhhosehgnhhurdhorhhgpdhrtghpthhtohepshhtvghfrghnkhgrnhhgrg hssehgmhgrihhlrdgtohhmpdhrtghpthhtohepvghlihiisehgnhhurdhorhhg X-ME-Proxy: <xmx:T2PHZxoKdVglXOlXWKHydrzrEhKx-w0bDxXovYDKNwzoN4eY7Rb8-w> <xmx:T2PHZ2ptJOmHogTedy91-E5fYzY4C9CpN91NofWbmWzfgw2_VyiCvg> <xmx:T2PHZ3RubkmlfZQkKaUf6AsJKxjxSnuXg934-pObUWXDgYhyfFOBtA> <xmx:T2PHZ-rQzli_RMvdGCkmFsf7WZrqxSA80omFC19WnYxS97a2pCjuLg> <xmx:T2PHZzCA4-XJJxAxkKYkERtIkt71pXiTFEy6JClc2ao7zb_N_t-DHoxF> Feedback-ID: i74194916:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Tue, 4 Mar 2025 15:32:14 -0500 (EST) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> <86senspow7.fsf@HIDDEN> User-agent: mu4e 1.10.8; emacs 31.0.50 From: john muhl <jm@HIDDEN> Date: Tue, 04 Mar 2025 14:17:15 -0600 In-reply-to: <86senspow7.fsf@HIDDEN> Message-ID: <8734fs35bx.fsf@HIDDEN> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Received-SPF: pass client-ip=202.12.124.153; envelope-from=jm@HIDDEN; helo=fhigh-b2-smtp.messagingengine.com X-Spam_score_int: -27 X-Spam_score: -2.8 X-Spam_bar: -- X-Spam_report: (-2.8 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_VALIDITY_RPBL_BLOCKED=0.001, RCVD_IN_VALIDITY_SAFE_BLOCKED=0.001, SPF_HELO_PASS=-0.001, SPF_PASS=-0.001 autolearn=ham autolearn_force=no X-Spam_action: no action X-Spam-Score: 0.7 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -0.3 (/) Eli Zaretskii <eliz@HIDDEN> writes: >> From: john muhl <jm@HIDDEN> >> Cc: Eli Zaretskii <eliz@HIDDEN>, Andrea Corallo <acorallo@HIDDEN>, >> 76650 <at> debbugs.gnu.org, bug-gnu-emacs@HIDDEN >> Date: Tue, 04 Mar 2025 12:50:03 -0600 >>=20 >>=20 >> Stefan Kangas <stefankangas@HIDDEN> writes: >>=20 >> > jm@HIDDEN writes: >> > >> >> I=E2=80=99ve talked with Denis (the current maintainer) about integra= ting >> >> lua-mode into Emacs and they are in favor of it. If there is >> >> interest on the Emacs side I can send over the list of >> >> contributors for assignment verification. There are about a dozen >> >> authors with contributions over the exempted 15 lines and most of >> >> those I was able to find commits from in emacs.git. >> > >> > Sounds like a good plan, thank you. LUA is quite popular, so I think = it >> > would be important to have built-in support for it, also it would help >> > us develop lua-ts-mode. >> > >> > I don't know if Eli or Andrea have any further comments, but I'd say go >> > for it. >>=20 >> Should I send the list of contributors to anyone in particular to >> check on assignment status or just post them here? Should I >> include email addresses in the list? > > Please post the list here, including email addresses. > > Thanks. The list is based on the current code in lua-mode.el. The list of all contributors is somewhat longer but I guessed that copyright is a non-issue for code that is no longer in use. It also doesn=E2=80=99t include those who only changed tests. lua-mode doesn=E2=80=99t use ERT for testing so I don=E2=80=99t think we=E2=80=99ll be importing that code anywa= y. The second group of names are those who should be exempt based on a 15 line limit. Augusto Stoffel arstoffel@HIDDEN Jonas Bernoulli jonas@HIDDEN Juergen Hoetzel juergen@HIDDEN Julien Danjou julien@HIDDEN Mark Oteiza mvoteiza@HIDDEN Nikita Bloshchanevich nikblos@HIDDEN Philip K philipk@HIDDEN Reuben Thomas rrt@HIDDEN Robert Cochran robert-git@HIDDEN Rolando Pereira rolando_pereira@HIDDEN Stefan Kangas stefan@HIDDEN USAMI Kenta tadsan@HIDDEN Vedat Hallac vedathallac@HIDDEN immerrr immerrr+lua@HIDDEN Dmitry Kalinkin dmitry.kalinkin@HIDDEN c1b60197 Edward Betts edward@HIDDEN 5a906553 Joram Schrijver i@HIDDEN dccda192 Leonardo Etcheverry leo@HIDDEN 91b59745 4a203b9e b9541cef Libor =C4=8Cap=C3=A1k capak@HIDDEN Mario Rodas marsam@HIDDEN Peter Vasil mail@HIDDEN Rafael Sanchez rafael@HIDDEN Thomas Jost schnouki@HIDDEN edam tim@HIDDEN paralogismos mailbowling@HIDDEN xristos xristos@HIDDEN
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: john muhl <jm@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Tue, 04 Mar 2025 20:33:02 +0000 Resent-Message-ID: <handler.76650.B76650.174112035726288 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Eli Zaretskii <eliz@HIDDEN> Cc: 76650 <at> debbugs.gnu.org, acorallo@HIDDEN, stefankangas@HIDDEN X-Debbugs-Original-Cc: bug-gnu-emacs@HIDDEN, acorallo@HIDDEN, stefankangas@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.174112035726288 (code B ref 76650); Tue, 04 Mar 2025 20:33:02 +0000 Received: (at 76650) by debbugs.gnu.org; 4 Mar 2025 20:32:37 +0000 Received: from localhost ([127.0.0.1]:33131 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpYwE-0006pa-SS for submit <at> debbugs.gnu.org; Tue, 04 Mar 2025 15:32:37 -0500 Received: from fhigh-b2-smtp.messagingengine.com ([202.12.124.153]:44109) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <jm@HIDDEN>) id 1tpYw9-0006ou-M2 for 76650 <at> debbugs.gnu.org; Tue, 04 Mar 2025 15:32:24 -0500 Received: from phl-compute-05.internal (phl-compute-05.phl.internal [10.202.2.45]) by mailfhigh.stl.internal (Postfix) with ESMTP id A764A25400D7; Tue, 4 Mar 2025 15:32:15 -0500 (EST) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-05.internal (MEProxy); Tue, 04 Mar 2025 15:32:15 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pub.pink; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1741120335; x=1741206735; bh=pMsuYafnhrunBbJxK3CCYRdY1H5tmq8HY0tqrQ8BE2Q=; b= wwveXS5QpzrJ521q79+byeCKwGu+nIcXZxVEaYw6ZguNHM2rwcUymf9hhGRFycRx foY4h7dDzeiCW49R1B3N+CkcmFi9ePsZOdnYZmDFu48NnHB4iutqTUmwBsrEwcdg CUXN4Ks1Yk0RKj6dg2ccl4HlOMF3fIVbKVhTXwdQaotREwOtJ2mGNe4a5zd711zx DNQT7+zIsACn0OrFObrjbPsogMQTGsVMBAgUv3xRZ/dIWbZFZLC0oal186qPmBQM uVYO4s5NlNHk1zEFak1pfm7I8UJpfmFlIbDOKOQAnX8aofssuQhCLDnKbSUaMH/R 7IldsUQQA2B1z+lz6uqbpg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1741120335; x= 1741206735; bh=pMsuYafnhrunBbJxK3CCYRdY1H5tmq8HY0tqrQ8BE2Q=; b=n 0WAlBI/MexT12ADabuxvWHpcUyEIyOdQy2fsEN4HCKOYp2Crk2dEeb59m2JAOpem U+szIhigI7bscwyGXvU1coPHfQvOOtGtLO2fOrS22LQATsd2jtlVu3nveHXm5Qlt 82p9M2B5Gp3wsvhcdAWeCr4gF/9Wtj8iT1UCUOx1OafjKT2ACcQ323+cTz5FMIvh RIDhn0ecSF367+HrCOGLoNmJCPHkgHyvp1HBJ8JoPUwU/qj3KsHHh06lNYBpyVf+ AoKBUAKa27jXYsLRlHiq1ylnDtim5dlgKm827h/Zqn7aOfRuY8b9tUm09TVRmyO+ Y4KDBzUB4v97x+q6pp7+w== X-ME-Sender: <xms:T2PHZ7Z-IJzN7zYbXNB9Lu7P2xsNKsXnRnkv2Vts6E9F29K3FNMn8w> <xme:T2PHZ6aTa5dlEHsg8SoBSmYlJhNKKgifDSdIIHBxOib3BzmCqG08_LUaFK0z-3U26 q-oCKD3AkvlkpV_1wc> X-ME-Received: <xmr:T2PHZ99Z3Scl810YVqLuSIPGNwfLAJrzOAeiJrWAHWFtLerrA2e8Cg> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutdeftdduucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhepfhgfhffvvefuffgjkfggtgfgsehtqhertddt reejnecuhfhrohhmpehjohhhnhcumhhuhhhluceojhhmsehpuhgsrdhpihhnkheqnecugg ftrfgrthhtvghrnhepieeuudegtdevheejheduueeiuddukeffkedvkeekfefhveegtedv udegffeuleehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrh homhepjhhmsehpuhgsrdhpihhnkhdpnhgspghrtghpthhtohephedpmhhouggvpehsmhht phhouhhtpdhrtghpthhtohepsghughdqghhnuhdqvghmrggtshesghhnuhdrohhrghdprh gtphhtthhopeejieeihedtseguvggssghughhsrdhgnhhurdhorhhgpdhrtghpthhtohep rggtohhrrghllhhosehgnhhurdhorhhgpdhrtghpthhtohepshhtvghfrghnkhgrnhhgrg hssehgmhgrihhlrdgtohhmpdhrtghpthhtohepvghlihiisehgnhhurdhorhhg X-ME-Proxy: <xmx:T2PHZxoKdVglXOlXWKHydrzrEhKx-w0bDxXovYDKNwzoN4eY7Rb8-w> <xmx:T2PHZ2ptJOmHogTedy91-E5fYzY4C9CpN91NofWbmWzfgw2_VyiCvg> <xmx:T2PHZ3RubkmlfZQkKaUf6AsJKxjxSnuXg934-pObUWXDgYhyfFOBtA> <xmx:T2PHZ-rQzli_RMvdGCkmFsf7WZrqxSA80omFC19WnYxS97a2pCjuLg> <xmx:T2PHZzCA4-XJJxAxkKYkERtIkt71pXiTFEy6JClc2ao7zb_N_t-DHoxF> Feedback-ID: i74194916:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Tue, 4 Mar 2025 15:32:14 -0500 (EST) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> <86senspow7.fsf@HIDDEN> User-agent: mu4e 1.10.8; emacs 31.0.50 From: john muhl <jm@HIDDEN> Date: Tue, 04 Mar 2025 14:17:15 -0600 In-reply-to: <86senspow7.fsf@HIDDEN> Message-ID: <8734fs35bx.fsf@HIDDEN> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) Eli Zaretskii <eliz@HIDDEN> writes: >> From: john muhl <jm@HIDDEN> >> Cc: Eli Zaretskii <eliz@HIDDEN>, Andrea Corallo <acorallo@HIDDEN>, >> 76650 <at> debbugs.gnu.org, bug-gnu-emacs@HIDDEN >> Date: Tue, 04 Mar 2025 12:50:03 -0600 >>=20 >>=20 >> Stefan Kangas <stefankangas@HIDDEN> writes: >>=20 >> > jm@HIDDEN writes: >> > >> >> I=E2=80=99ve talked with Denis (the current maintainer) about integra= ting >> >> lua-mode into Emacs and they are in favor of it. If there is >> >> interest on the Emacs side I can send over the list of >> >> contributors for assignment verification. There are about a dozen >> >> authors with contributions over the exempted 15 lines and most of >> >> those I was able to find commits from in emacs.git. >> > >> > Sounds like a good plan, thank you. LUA is quite popular, so I think = it >> > would be important to have built-in support for it, also it would help >> > us develop lua-ts-mode. >> > >> > I don't know if Eli or Andrea have any further comments, but I'd say go >> > for it. >>=20 >> Should I send the list of contributors to anyone in particular to >> check on assignment status or just post them here? Should I >> include email addresses in the list? > > Please post the list here, including email addresses. > > Thanks. The list is based on the current code in lua-mode.el. The list of all contributors is somewhat longer but I guessed that copyright is a non-issue for code that is no longer in use. It also doesn=E2=80=99t include those who only changed tests. lua-mode doesn=E2=80=99t use ERT for testing so I don=E2=80=99t think we=E2=80=99ll be importing that code anywa= y. The second group of names are those who should be exempt based on a 15 line limit. Augusto Stoffel arstoffel@HIDDEN Jonas Bernoulli jonas@HIDDEN Juergen Hoetzel juergen@HIDDEN Julien Danjou julien@HIDDEN Mark Oteiza mvoteiza@HIDDEN Nikita Bloshchanevich nikblos@HIDDEN Philip K philipk@HIDDEN Reuben Thomas rrt@HIDDEN Robert Cochran robert-git@HIDDEN Rolando Pereira rolando_pereira@HIDDEN Stefan Kangas stefan@HIDDEN USAMI Kenta tadsan@HIDDEN Vedat Hallac vedathallac@HIDDEN immerrr immerrr+lua@HIDDEN Dmitry Kalinkin dmitry.kalinkin@HIDDEN c1b60197 Edward Betts edward@HIDDEN 5a906553 Joram Schrijver i@HIDDEN dccda192 Leonardo Etcheverry leo@HIDDEN 91b59745 4a203b9e b9541cef Libor =C4=8Cap=C3=A1k capak@HIDDEN Mario Rodas marsam@HIDDEN Peter Vasil mail@HIDDEN Rafael Sanchez rafael@HIDDEN Thomas Jost schnouki@HIDDEN edam tim@HIDDEN paralogismos mailbowling@HIDDEN xristos xristos@HIDDEN
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: Eli Zaretskii <eliz@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Wed, 05 Mar 2025 12:31:02 +0000 Resent-Message-ID: <handler.76650.B76650.174117785925557 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: john muhl <jm@HIDDEN> Cc: acorallo@HIDDEN, stefankangas@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.174117785925557 (code B ref 76650); Wed, 05 Mar 2025 12:31:02 +0000 Received: (at 76650) by debbugs.gnu.org; 5 Mar 2025 12:30:59 +0000 Received: from localhost ([127.0.0.1]:35985 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpntg-0006HT-GP for submit <at> debbugs.gnu.org; Wed, 05 Mar 2025 07:30:59 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:42230) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <eliz@HIDDEN>) id 1tpntb-0005w3-VQ for 76650 <at> debbugs.gnu.org; Wed, 05 Mar 2025 07:30:46 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <eliz@HIDDEN>) id 1tpntU-0001y5-3j; Wed, 05 Mar 2025 07:30:36 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=Mn3TR+0qBrlEg6P5S6u+UBNpCmLHP98gTjYhSt7I9bM=; b=qE/V3x6qApn58fd/agxC sb9IXKsgsHoI74slLOMDBKzdrpFphSkgOJBEcCWHpnjxX8TQ4qivIdUqaP1NgcsavVGUSMXPHNogj tRBhMrJzz4Kmfvk0KkiDzy7YxOWZ66/t9O/lRwkzSGMEawW+7/PryqzRFoI4PF1wk82yq83Hzc5Jw yo6jt/hbkfLg4rW9GWjXRbCf+BPm8Ddq5zWdHpprjb129tu37o4T596gk6HX2ZAhypaX9qTepuu5V LHFwEYHBVXth97GucgDiDnaV2/x0kvLT+Moq3aJVHXodwqXmHbk6rcTWnCJqtm8x+poaCHvtHIIOt aTLAhETZOXkqrA==; Date: Wed, 05 Mar 2025 14:30:28 +0200 Message-Id: <86jz93psm3.fsf@HIDDEN> From: Eli Zaretskii <eliz@HIDDEN> In-Reply-To: <8734fs35bx.fsf@HIDDEN> (message from john muhl on Tue, 04 Mar 2025 14:17:15 -0600) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> <86senspow7.fsf@HIDDEN> <8734fs35bx.fsf@HIDDEN> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) > From: john muhl <jm@HIDDEN> > Cc: stefankangas@HIDDEN, acorallo@HIDDEN, 76650 <at> debbugs.gnu.org, > bug-gnu-emacs@HIDDEN > Date: Tue, 04 Mar 2025 14:17:15 -0600 > > > Eli Zaretskii <eliz@HIDDEN> writes: > > > Please post the list here, including email addresses. > > > > Thanks. > > The list is based on the current code in lua-mode.el. The list of > all contributors is somewhat longer but I guessed that copyright > is a non-issue for code that is no longer in use. It also doesn’t > include those who only changed tests. lua-mode doesn’t use ERT for > testing so I don’t think we’ll be importing that code anyway. > > The second group of names are those who should be exempt based on > a 15 line limit. > > Augusto Stoffel arstoffel@HIDDEN > Jonas Bernoulli jonas@HIDDEN > Juergen Hoetzel juergen@HIDDEN > Julien Danjou julien@HIDDEN > Mark Oteiza mvoteiza@HIDDEN > Nikita Bloshchanevich nikblos@HIDDEN > Philip K philipk@HIDDEN > Reuben Thomas rrt@HIDDEN > Robert Cochran robert-git@HIDDEN > Rolando Pereira rolando_pereira@HIDDEN > Stefan Kangas stefan@HIDDEN > USAMI Kenta tadsan@HIDDEN > Vedat Hallac vedathallac@HIDDEN > immerrr immerrr+lua@HIDDEN Out of these, only the following don't already have assignments on file: Nikita Bloshchanevich nikblos@HIDDEN Rolando Pereira rolando_pereira@HIDDEN > Dmitry Kalinkin dmitry.kalinkin@HIDDEN c1b60197 > Edward Betts edward@HIDDEN 5a906553 > Joram Schrijver i@HIDDEN dccda192 > Leonardo Etcheverry leo@HIDDEN 91b59745 4a203b9e b9541cef > Libor Čapák capak@HIDDEN > Mario Rodas marsam@HIDDEN > Peter Vasil mail@HIDDEN > Rafael Sanchez rafael@HIDDEN > Thomas Jost schnouki@HIDDEN > edam tim@HIDDEN > paralogismos mailbowling@HIDDEN > xristos xristos@HIDDEN None of these have assignments.
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: john muhl <jm@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Wed, 05 Mar 2025 15:42:01 +0000 Resent-Message-ID: <handler.76650.B76650.174118931624978 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Eli Zaretskii <eliz@HIDDEN> Cc: acorallo@HIDDEN, stefankangas@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.174118931624978 (code B ref 76650); Wed, 05 Mar 2025 15:42:01 +0000 Received: (at 76650) by debbugs.gnu.org; 5 Mar 2025 15:41:56 +0000 Received: from localhost ([127.0.0.1]:39175 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpqsV-0006Ua-8F for submit <at> debbugs.gnu.org; Wed, 05 Mar 2025 10:41:56 -0500 Received: from fout-a2-smtp.messagingengine.com ([103.168.172.145]:48423) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <jm@HIDDEN>) id 1tpqsR-0006UG-4B for 76650 <at> debbugs.gnu.org; Wed, 05 Mar 2025 10:41:44 -0500 Received: from phl-compute-01.internal (phl-compute-01.phl.internal [10.202.2.41]) by mailfout.phl.internal (Postfix) with ESMTP id 574451380A2E; Wed, 5 Mar 2025 10:41:37 -0500 (EST) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-01.internal (MEProxy); Wed, 05 Mar 2025 10:41:37 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pub.pink; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1741189297; x=1741275697; bh=FNv0JskjvPyEias3ZOO6t8pr3zjVn6LEa0vF61SqkFs=; b= HbvvebAIVRDhf0ZBD95B2ZjG6nzQ182h/6mmyOhAYNkdgiwAl8K8dhqiN3+hdc9q Z3piQlvU6w1/rIKpxJoEMyClIuE8RMxthImADP1R4UlhBM/HGXRi8fE68Acpaewm B14V0imy+vEiVewf4dWORC/UB5A+Su8sheSqd2ax77FW76VWF3DDLbV8zQ0ovOsx Hj/ancsU0ranEGgz2UAFaRH6m3XHokoNJc0MLB38E+v5QE0/uWAOTzpLCeEiFE/9 Juex+Ied+GXSe4U/o6Py1mgY/H9IWrbpzNS0sm0G1qaiJywfmNxqHVuvELUOuzJ2 +XyKne2TAxKwYtYfz9vi4A== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1741189297; x= 1741275697; bh=FNv0JskjvPyEias3ZOO6t8pr3zjVn6LEa0vF61SqkFs=; b=s atbJjNTdJTsfOHs/jG5b5R9ExufaW88owaw7eq4rcmZxaDe3t+vwKETV1KNkXJTl zOJ/H094HwXQuGdSYoOahZuZamj95t/vUXYRMYTXJsinwbFTFma0i/laEYsFrmbh yOjK9ozw+JSaFKxe955DjHBGOOTUjAoVY5uAAMcLR+myn2W8HaY3n36jtFWf3jb5 F0bmSS4C6n1xAI7Pkfboa0TuXZ2+BlmpotfwMZEjxzyHC1kmED7I0AwXX4Je3Dly rTeAt0Rp0k8St9yObFmx3SEeaPgl40GU0PjAFNyAQo/1wBVh094C3dQHqZgBlNC0 mY++lDjUl9p7+mFgcZGkQ== X-ME-Sender: <xms:sXDIZ7Kv4xT_dd8kIidGILOp8ymavYR0CssIMKk_a7I4Olbi_5kK3w> <xme:sXDIZ_LW2RADbaHLGmRHt_P_Sc5G_xQi_uYxp05WBhOCwaSDZVw9JBrzCXbPfYzb0 HyN0LL-Mi7CXr0W0Cw> X-ME-Received: <xmr:sXDIZztJVt5ev6f-8zhGimJ6SGZDgD08B0ofpGoaavP7OIhyu2j2BQ> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutdehvddtucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhepfhgfhffvvefuffgjkfggtgfgsehtqhertddt reejnecuhfhrohhmpehjohhhnhcumhhuhhhluceojhhmsehpuhgsrdhpihhnkheqnecugg ftrfgrthhtvghrnhepieeuudegtdevheejheduueeiuddukeffkedvkeekfefhveegtedv udegffeuleehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrh homhepjhhmsehpuhgsrdhpihhnkhdpnhgspghrtghpthhtohepgedpmhhouggvpehsmhht phhouhhtpdhrtghpthhtohepjeeiieehtdesuggvsggsuhhgshdrghhnuhdrohhrghdprh gtphhtthhopegrtghorhgrlhhlohesghhnuhdrohhrghdprhgtphhtthhopehsthgvfhgr nhhkrghnghgrshesghhmrghilhdrtghomhdprhgtphhtthhopegvlhhiiiesghhnuhdroh hrgh X-ME-Proxy: <xmx:sXDIZ0aczyHNNmGwTSywt4eQP1tzG29u9rSMC7gLZB5vjthMy7R3fg> <xmx:sXDIZyYymOxUXtQ6EK8G9XFagbdM_DE4lYuce7LzSFzBd1vcHau2vg> <xmx:sXDIZ4AayiltcUbOAwpikP2WoYL4JTU_QvdLywPv8HOcJvosYmkDYQ> <xmx:sXDIZwbaeT-pHRwSuzAPcqR9tfk04S4FJP7Y0RIiDxFo3V7e7MvGMA> <xmx:sXDIZ5Vj7m4eBmAzsw7IBsuyu8p6crUKhT-q49CL7zg9azKi4wc7cBdo> Feedback-ID: i74194916:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 5 Mar 2025 10:41:36 -0500 (EST) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> <86senspow7.fsf@HIDDEN> <8734fs35bx.fsf@HIDDEN> <86jz93psm3.fsf@HIDDEN> User-agent: mu4e 1.10.8; emacs 31.0.50 From: john muhl <jm@HIDDEN> Date: Wed, 05 Mar 2025 09:06:41 -0600 In-reply-to: <86jz93psm3.fsf@HIDDEN> Message-ID: <87plivh4d4.fsf@HIDDEN> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) Eli Zaretskii <eliz@HIDDEN> writes: >> From: john muhl <jm@HIDDEN> >> Cc: stefankangas@HIDDEN, acorallo@HIDDEN, 76650 <at> debbugs.gnu.org, >> bug-gnu-emacs@HIDDEN >> Date: Tue, 04 Mar 2025 14:17:15 -0600 >>=20 >>=20 >> Eli Zaretskii <eliz@HIDDEN> writes: >>=20 > Out of these, only the following don't already have assignments on > file: Thanks. We=E2=80=99re in even better shape than I thought. A second check of the remainer shows: Leonardo Etcheverry leo@HIDDEN 13 lines code 6 lines comments Nikita Bloshchanevich nikblos@HIDDEN 15 lines code 3 lines comments 3 lines docstrings edam tim@HIDDEN 12 lines code 6 lines comments 6 lines docstrings 2 Dmitry Kalinkin dmitry.kalinkin@HIDDEN 1 Edward Betts edward@HIDDEN 2 Joram Schrijver i@HIDDEN dccda192 6 Libor =C4=8Cap=C3=A1k capak@HIDDEN 3 Mario Rodas marsam@HIDDEN 2 Peter Vasil mail@HIDDEN 2 Rafael Sanchez rafael@HIDDEN 7 Rolando Pereira rolando_pereira@HIDDEN 11 Thomas Jost schnouki@HIDDEN 9 paralogismos mailbowling@HIDDEN 6 xristos xristos@HIDDEN > None of these have assignments. Do we need assignments for any of these?
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: Eli Zaretskii <eliz@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Wed, 05 Mar 2025 16:14:02 +0000 Resent-Message-ID: <handler.76650.B76650.174119120331121 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: john muhl <jm@HIDDEN> Cc: acorallo@HIDDEN, stefankangas@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.174119120331121 (code B ref 76650); Wed, 05 Mar 2025 16:14:02 +0000 Received: (at 76650) by debbugs.gnu.org; 5 Mar 2025 16:13:23 +0000 Received: from localhost ([127.0.0.1]:39241 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tprMx-00085g-KW for submit <at> debbugs.gnu.org; Wed, 05 Mar 2025 11:13:22 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:33932) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <eliz@HIDDEN>) id 1tprMu-00085M-EB for 76650 <at> debbugs.gnu.org; Wed, 05 Mar 2025 11:13:14 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <eliz@HIDDEN>) id 1tprMo-0007b2-Sz; Wed, 05 Mar 2025 11:13:06 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=MIME-version:References:Subject:In-Reply-To:To:From: Date; bh=iX/Wrh8vDeUzdKecMIEazV5myfY53RAgBg1AI+dPdR0=; b=DNTLUP/sB6Xyjf6kc4r+ VO+UkXWfnfd1mRFre08msoAkG8/kM6q4EPvX2aQNU/7YNI4xcNEERPymU73nzA4bSVTYrG/T5GBdg DlPeDQOn8loMaPt9I92IZUTKguHzUXXA/xnYSzgVyX9R1phW3W1OCF5MFmtjQr/E9CEoEWO6VRRKr RIjhFXdMMOMjT0d9aSUaCV/3/ti/DbkvqvGcxNN+uLx/bfg+JxEUQOxpNnOrH31ssqBAkOJ/HhN1w c6kwwIiRp6aCjtbIPQpyHKfYiWsxi+CnZmaXui8o5JpP6vHu0kGcqhOvgRrPLVNsN1CSrpHnwp/X2 JSBLYd5mphkESg==; Date: Wed, 05 Mar 2025 18:13:01 +0200 Message-Id: <86jz93o3qq.fsf@HIDDEN> From: Eli Zaretskii <eliz@HIDDEN> In-Reply-To: <87plivh4d4.fsf@HIDDEN> (message from john muhl on Wed, 05 Mar 2025 09:06:41 -0600) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> <86senspow7.fsf@HIDDEN> <8734fs35bx.fsf@HIDDEN> <86jz93psm3.fsf@HIDDEN> <87plivh4d4.fsf@HIDDEN> MIME-version: 1.0 Content-type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-Spam-Score: -2.3 (--) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) > From: john muhl <jm@HIDDEN> > Cc: stefankangas@HIDDEN, acorallo@HIDDEN, 76650 <at> debbugs.gnu.org > Date: Wed, 05 Mar 2025 09:06:41 -0600 > > > > Out of these, only the following don't already have assignments on > > file: > > Thanks. We’re in even better shape than I thought. A second check > of the remainer shows: > > Leonardo Etcheverry leo@HIDDEN > 13 lines code > 6 lines comments > > Nikita Bloshchanevich nikblos@HIDDEN > 15 lines code > 3 lines comments > 3 lines docstrings > > edam tim@HIDDEN > 12 lines code > 6 lines comments > 6 lines docstrings > > 2 Dmitry Kalinkin dmitry.kalinkin@HIDDEN > 1 Edward Betts edward@HIDDEN > 2 Joram Schrijver i@HIDDEN dccda192 > 6 Libor Čapák capak@HIDDEN > 3 Mario Rodas marsam@HIDDEN > 2 Peter Vasil mail@HIDDEN > 2 Rafael Sanchez rafael@HIDDEN > 7 Rolando Pereira rolando_pereira@HIDDEN > 11 Thomas Jost schnouki@HIDDEN > 9 paralogismos mailbowling@HIDDEN > 6 xristos xristos@HIDDEN > > > None of these have assignments. > > Do we need assignments for any of these? No, we don't.
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: john muhl <jm@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Wed, 05 Mar 2025 16:39:01 +0000 Resent-Message-ID: <handler.76650.B76650.17411927383707 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Eli Zaretskii <eliz@HIDDEN> Cc: acorallo@HIDDEN, stefankangas@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.17411927383707 (code B ref 76650); Wed, 05 Mar 2025 16:39:01 +0000 Received: (at 76650) by debbugs.gnu.org; 5 Mar 2025 16:38:58 +0000 Received: from localhost ([127.0.0.1]:39303 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tprli-0000xZ-7c for submit <at> debbugs.gnu.org; Wed, 05 Mar 2025 11:38:58 -0500 Received: from fout-a3-smtp.messagingengine.com ([103.168.172.146]:42851) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <jm@HIDDEN>) id 1tprle-0000xE-Rp for 76650 <at> debbugs.gnu.org; Wed, 05 Mar 2025 11:38:48 -0500 Received: from phl-compute-13.internal (phl-compute-13.phl.internal [10.202.2.53]) by mailfout.phl.internal (Postfix) with ESMTP id ABE3A13826FB; Wed, 5 Mar 2025 11:38:41 -0500 (EST) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-13.internal (MEProxy); Wed, 05 Mar 2025 11:38:41 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pub.pink; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1741192721; x=1741279121; bh=6L6Wc/N+5NSPbbRmoUr/G+n2wOLJAiiTd7ugSwOacec=; b= L/qIoNllhv6ZRExZZLmzieJZMI3eepQowaDBAJvw+2e1JTYgyr47mzhw08usf5T0 5lJVuHw1sXhwBK/lRt1u9057Vo6dt0U+zn9gWD7lLJIpi1rJJCOWXJbCphxtNeKE 2PLE4G/mCUQ8Fhog3fhxTexYs8BvXmhmzkO1piPJxSfh9FtJ36nT2tBKJMcR35rt x9TJxsDpLUG6KnnnM1MZzlSPgFpe6ejZj33Kzo19l0P8ZKny0/vsxmJjaZ1VIz5/ FZHkRbkv/LQZAb8Ug+Xb+aSERzlcbKK+Yuc0dfCFd61hmCt9wM70UEo4VuzgQalV mbOAA5QdVRQPeXU2eua5tA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1741192721; x= 1741279121; bh=6L6Wc/N+5NSPbbRmoUr/G+n2wOLJAiiTd7ugSwOacec=; b=M HwNNY7ze7swhjBJ8+6iUgjhpHptZ6J1wQbTtnuUKgeJCqomhNrQO4B0jdQhGmD5F XDhHKmv27Rl+5QshTb3J9PLfjWDye+yMBJuYPXcvBgE4NI3gEwuWsT1r9QoS/WPZ WvNJcLjbgdlU0dIZ5uWzwWukUVyzOyFfKuboiyQtQk6d2eyj1P2vmAOit8YvkOz6 33hPdNM3Pil5ixhorHzyT9fb6tOp23BIafUIbwR6gmivgkRZF+yFvRVi3nSfFIIJ M3S1qk09BBPrWgrRihdaC9hphFvW0+kybLIsOi4W1Fkja3uttMXJs9vVTrozEGKP WCgI1jfNn7M3CAzhVfeoA== X-ME-Sender: <xms:EX7IZ2zjfsjo5IzkK6r87O9Gn3QsbqDeqPsJY1r-XeK2LVBqGbqh1A> <xme:EX7IZyT53_UYkX_8ljIXn35mvqliGSLZ6JH42i7-cRAAx7Y_pbanb8Ld1IgXcrpoy PMdlZQUrj82KETII24> X-ME-Received: <xmr:EX7IZ4XEw8ZRTRQnm0Wt_PglCScqxHyswakRwEaEK8RIJHA4FdOP_Q> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutdehfeefucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhepfhgfhffvvefuffgjkfggtgfgsehtqhertddt reejnecuhfhrohhmpehjohhhnhcumhhuhhhluceojhhmsehpuhgsrdhpihhnkheqnecugg ftrfgrthhtvghrnhepieeuudegtdevheejheduueeiuddukeffkedvkeekfefhveegtedv udegffeuleehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrh homhepjhhmsehpuhgsrdhpihhnkhdpnhgspghrtghpthhtohepgedpmhhouggvpehsmhht phhouhhtpdhrtghpthhtohepjeeiieehtdesuggvsggsuhhgshdrghhnuhdrohhrghdprh gtphhtthhopegrtghorhgrlhhlohesghhnuhdrohhrghdprhgtphhtthhopehsthgvfhgr nhhkrghnghgrshesghhmrghilhdrtghomhdprhgtphhtthhopegvlhhiiiesghhnuhdroh hrgh X-ME-Proxy: <xmx:EX7IZ8iWaUmHRQ720hTXYOLwfXeeJ0cp6QULn0GaWPAaPFk6RdtObg> <xmx:EX7IZ4CnEMynZgkVXO8wBlsFnAnoDG387bNsLfinbgDqvIjFUcehAA> <xmx:EX7IZ9LtesR0XBnH4uSDAGKSCoTHLnoWGRBALQ39yfcEHUqmQA-S3Q> <xmx:EX7IZ_B_N-YfacSoH6URjCiGiTg3Ahw28tbU3Me2a_VDeh5VOKEyvA> <xmx:EX7IZ78cPwjhuuKUDm4mKGXTFPCov-hAwGvskyjfTJtQeXGvKGeBhfr5> Feedback-ID: i74194916:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 5 Mar 2025 11:38:40 -0500 (EST) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> <86senspow7.fsf@HIDDEN> <8734fs35bx.fsf@HIDDEN> <86jz93psm3.fsf@HIDDEN> <87plivh4d4.fsf@HIDDEN> <86jz93o3qq.fsf@HIDDEN> User-agent: mu4e 1.10.8; emacs 31.0.50 From: john muhl <jm@HIDDEN> Date: Wed, 05 Mar 2025 10:33:20 -0600 In-reply-to: <86jz93o3qq.fsf@HIDDEN> Message-ID: <87jz93fn5f.fsf@HIDDEN> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) Eli Zaretskii <eliz@HIDDEN> writes: >> From: john muhl <jm@HIDDEN> >> Cc: stefankangas@HIDDEN, acorallo@HIDDEN, 76650 <at> debbugs.gnu.org >> Date: Wed, 05 Mar 2025 09:06:41 -0600 >>=20 >>=20 >> > Out of these, only the following don't already have assignments on >> > file: >>=20 >> Thanks. We=E2=80=99re in even better shape than I thought. A second check >> of the remainer shows: >>=20 >> Leonardo Etcheverry leo@HIDDEN >> 13 lines code >> 6 lines comments >>=20 >> Nikita Bloshchanevich nikblos@HIDDEN >> 15 lines code >> 3 lines comments >> 3 lines docstrings >>=20 >> edam tim@HIDDEN >> 12 lines code >> 6 lines comments >> 6 lines docstrings >>=20 >> 2 Dmitry Kalinkin dmitry.kalinkin@HIDDEN >> 1 Edward Betts edward@HIDDEN >> 2 Joram Schrijver i@HIDDEN dccda192 >> 6 Libor =C4=8Cap=C3=A1k capak@HIDDEN >> 3 Mario Rodas marsam@HIDDEN >> 2 Peter Vasil mail@HIDDEN >> 2 Rafael Sanchez rafael@HIDDEN >> 7 Rolando Pereira rolando_pereira@HIDDEN >> 11 Thomas Jost schnouki@HIDDEN >> 9 paralogismos mailbowling@HIDDEN >> 6 xristos xristos@HIDDEN >>=20 >> > None of these have assignments. >>=20 >> Do we need assignments for any of these? > > No, we don't. Then one last procedural question before I get started on that initial commit. Do we want to preserve the git history or just bring it in as if it were new file? If the former should the commit messages all be cleaned up to conform to Emacs standards? Anything other requirements or considerations I should keep in mind while preparing for the import?
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: Eli Zaretskii <eliz@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Wed, 05 Mar 2025 19:05:02 +0000 Resent-Message-ID: <handler.76650.B76650.1741201446937 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: john muhl <jm@HIDDEN> Cc: acorallo@HIDDEN, stefankangas@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.1741201446937 (code B ref 76650); Wed, 05 Mar 2025 19:05:02 +0000 Received: (at 76650) by debbugs.gnu.org; 5 Mar 2025 19:04:06 +0000 Received: from localhost ([127.0.0.1]:39873 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpu2I-0000F2-6s for submit <at> debbugs.gnu.org; Wed, 05 Mar 2025 14:04:06 -0500 Received: from eggs.gnu.org ([2001:470:142:3::10]:33690) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <eliz@HIDDEN>) id 1tpu2F-0000ET-2a for 76650 <at> debbugs.gnu.org; Wed, 05 Mar 2025 14:04:04 -0500 Received: from fencepost.gnu.org ([2001:470:142:3::e]) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from <eliz@HIDDEN>) id 1tpu28-0000bZ-7a; Wed, 05 Mar 2025 14:03:56 -0500 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=gnu.org; s=fencepost-gnu-org; h=References:Subject:In-Reply-To:To:From:Date: mime-version; bh=SOvBXleqo1dCiHwdIfxIlm26Canff8hBJREWBZ39z3c=; b=E9z8ojXxi/e+ dX5Wp2MBnIj5pf2CrEyL1sCHDlKyBdsuNoX47G+TjEVuMBfolNPaBH0xju+TaN/cpd25H41KSOlgP WuOSWOgxGtTCBrDNwoi2fir1kCjyRnAv6VQsokhGGs6OVdkW8YJIM3v8T7Gc1yTwN24NmhR22bPVo Tm9HzNVQ3tDxsQDvNRyTZePeK8no1HXSA6BmNypGpxQtXBo1gOoCrniFLLxrKCa29PjcqFQh22gsF NN4z/dBB134yBdfsSrWdtLLxf4SEumML21ao/5PBr2YqmdtFQAhUW1SJLL8gpPpUhlLgzqRJrmSej mvBBh4rVtz9CwtpW4nUMPw==; Date: Wed, 05 Mar 2025 21:03:53 +0200 Message-Id: <86h647nvty.fsf@HIDDEN> From: Eli Zaretskii <eliz@HIDDEN> In-Reply-To: <87jz93fn5f.fsf@HIDDEN> (message from john muhl on Wed, 05 Mar 2025 10:33:20 -0600) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> <86senspow7.fsf@HIDDEN> <8734fs35bx.fsf@HIDDEN> <86jz93psm3.fsf@HIDDEN> <87plivh4d4.fsf@HIDDEN> <86jz93o3qq.fsf@HIDDEN> <87jz93fn5f.fsf@HIDDEN> X-Spam-Score: -2.3 (--) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -3.3 (---) > From: john muhl <jm@HIDDEN> > Cc: stefankangas@HIDDEN, acorallo@HIDDEN, 76650 <at> debbugs.gnu.org > Date: Wed, 05 Mar 2025 10:33:20 -0600 > > Then one last procedural question before I get started on that > initial commit. Do we want to preserve the git history or just > bring it in as if it were new file? It is best to preserve it. > If the former should the commit messages all be cleaned up to > conform to Emacs standards? Is that even practical?
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: Stefan Kangas <stefankangas@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Wed, 05 Mar 2025 19:32:02 +0000 Resent-Message-ID: <handler.76650.B76650.17412031206011 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Eli Zaretskii <eliz@HIDDEN>, john muhl <jm@HIDDEN> Cc: acorallo@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.17412031206011 (code B ref 76650); Wed, 05 Mar 2025 19:32:02 +0000 Received: (at 76650) by debbugs.gnu.org; 5 Mar 2025 19:32:00 +0000 Received: from localhost ([127.0.0.1]:39924 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpuTI-0001Ys-9Q for submit <at> debbugs.gnu.org; Wed, 05 Mar 2025 14:32:00 -0500 Received: from mail-ej1-x632.google.com ([2a00:1450:4864:20::632]:42022) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from <stefankangas@HIDDEN>) id 1tpuTF-0001Yd-7l for 76650 <at> debbugs.gnu.org; Wed, 05 Mar 2025 14:31:57 -0500 Received: by mail-ej1-x632.google.com with SMTP id a640c23a62f3a-abf4cebb04dso240402566b.0 for <76650 <at> debbugs.gnu.org>; Wed, 05 Mar 2025 11:31:57 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1741203111; x=1741807911; darn=debbugs.gnu.org; h=cc:to:subject:message-id:date:mime-version:references:in-reply-to :from:from:to:cc:subject:date:message-id:reply-to; bh=X9kSxwB55oLB0PxLMPoGMZaoPj6SPWMNocWRMxqwH80=; b=Ymf3OIDcHSnDw1LOXDdXX9fLRLAAvm8gFUpqq+aVC9wUu/o1Gj7DKW52PJTKKppfsv 0VQLx1WsXlKfDkIG9A5fccmBFTCUYt9g1CBI2s/SOKh/lpyfIXDWQqTa+/ne7nAdUssj AG37ZpkJnQ045aUQzGszSNV8XYAUKOaWkWku94WsLDGDRpaV8juoVxoexEdWqjrmXL7b XqgV/uoAIPpm1HzQhGHjKXHoo/8Kncl48AqjmfdyPTNHn7OuOKwDoBWi3GhYH2gXWjI6 gFGvzvK67ilFg3BTWsJJAH2U+IuzhmsBvW3BmZ+XiiJQt4seRrYnLK7BobYX9sJGArc/ S/7Q== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1741203111; x=1741807911; h=cc:to:subject:message-id:date:mime-version:references:in-reply-to :from:x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=X9kSxwB55oLB0PxLMPoGMZaoPj6SPWMNocWRMxqwH80=; b=sntcXk9f7+sXRgmrwUXNw48UK56kgnod0zReQ23lpbUl62Ai1TcNjTF8x5zzCNgd9C av11Pr97XiVdIhJ4XmacRuOG1176sUcOVOmM5F5Vmf692R1iAbyrQKoD78vf9nRBKdyo cT2Jkjn0PI4lDAf8Ns2SMGZGaonojyOw1I2+4mMfX7z/rqPQUxHNn3itbDj1zCzziq+F RpKdelRvcmqrotjkLaybDV4f8s64NmrnZ+Dw+zOvQDEpZU3cDdkqzM5/liAN1c3RpMMN 2QOjBH+1Tn5ZFTz+R3ZkfMTsUwOHjEZKjf9KQAfjqdZGlDr9us6G2isI5aOAxgo96Ora Z1Mg== X-Forwarded-Encrypted: i=1; AJvYcCUXPJuypt+S6XC3tD88uBIyh7kennBSuScsMr7iKVE/Zz/Ko5e6f92LHCigd9RqkIgjx6YTxg==@debbugs.gnu.org X-Gm-Message-State: AOJu0Yy1gY4fhgTx+yv0ZfNanGCo2W8TpqX682jo6YUHjNry1b5kT/Bi Yty7QwwCImEaUzIIU4XMBi5R4PBZAMzFktkGXeAe+oEMwEwD8NIE9rgFypvUjapQ7xlj11aEFEM ONDULMws0oIWhrxpYYBz0atxBYlIwe7r0 X-Gm-Gg: ASbGncsc02ZuMQztTQUjSrdn2Q2AHM3uFbcIpq8TIAK4yo9QNI6qQq9BR8OJ2zZJ41V h2W8eObZK5pBumoh+APLKOplAyA8MXDf/fd9emBvC0vTXADZRlHt6AVPsah/hGkblUvTsBgbtJR EeASGbGZBvyIFAJsAKEr5QDcULDQ== X-Google-Smtp-Source: AGHT+IGs9zl9CweIZvVUGk2mHAEr07LvbM4PEvDfyLb5E2pCJPVqTw2/4odgplCH6MsUbXapbUeSHE8U0csnKHk34f4= X-Received: by 2002:a17:907:9722:b0:ac2:9a4:700b with SMTP id a640c23a62f3a-ac22cb31721mr47087466b.16.1741203110810; Wed, 05 Mar 2025 11:31:50 -0800 (PST) Received: from 753933720722 named unknown by gmailapi.google.com with HTTPREST; Wed, 5 Mar 2025 11:31:50 -0800 From: Stefan Kangas <stefankangas@HIDDEN> In-Reply-To: <86h647nvty.fsf@HIDDEN> References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> <86senspow7.fsf@HIDDEN> <8734fs35bx.fsf@HIDDEN> <86jz93psm3.fsf@HIDDEN> <87plivh4d4.fsf@HIDDEN> <86jz93o3qq.fsf@HIDDEN> <87jz93fn5f.fsf@HIDDEN> <86h647nvty.fsf@HIDDEN> MIME-Version: 1.0 Date: Wed, 5 Mar 2025 11:31:50 -0800 X-Gm-Features: AQ5f1JqNMer77-2N45xQzwmZCMUgsuto89tgQ3QC24bG_HI3hazHBuG7oxwZ2k8 Message-ID: <CADwFkmk8Ua9e4f9tDv837MExLcvt4=RPtTvMpYwrtawztE358g@HIDDEN> Content-Type: text/plain; charset="UTF-8" X-Spam-Score: 0.0 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) Eli Zaretskii <eliz@HIDDEN> writes: >> From: john muhl <jm@HIDDEN> >> Cc: stefankangas@HIDDEN, acorallo@HIDDEN, 76650 <at> debbugs.gnu.org >> Date: Wed, 05 Mar 2025 10:33:20 -0600 >> >> Then one last procedural question before I get started on that >> initial commit. Do we want to preserve the git history or just >> bring it in as if it were new file? > > It is best to preserve it. Indeed. This is one possible starting point: https://gist.github.com/joaotavora/2ed97f2ec85958986983d5cb78202770 The idea is to put the changes on a separate branch containing only that one file in its right location, and then to merge that to master. >> If the former should the commit messages all be cleaned up to >> conform to Emacs standards? > > Is that even practical? It's not necessary, and its impractical. The commit that merges to master could have a ChangeLog entry like this: * lisp/progmodes/lua-mode.ts: New file.
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: john muhl <jm@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Thu, 06 Mar 2025 01:20:02 +0000 Resent-Message-ID: <handler.76650.B76650.174122394725063 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: Stefan Kangas <stefankangas@HIDDEN> Cc: Eli Zaretskii <eliz@HIDDEN>, acorallo@HIDDEN, 76650 <at> debbugs.gnu.org Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.174122394725063 (code B ref 76650); Thu, 06 Mar 2025 01:20:02 +0000 Received: (at 76650) by debbugs.gnu.org; 6 Mar 2025 01:19:07 +0000 Received: from localhost ([127.0.0.1]:40493 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tpztC-0006WA-NE for submit <at> debbugs.gnu.org; Wed, 05 Mar 2025 20:19:07 -0500 Received: from fhigh-b4-smtp.messagingengine.com ([202.12.124.155]:37489) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <jm@HIDDEN>) id 1tpzt9-0006VZ-Si for 76650 <at> debbugs.gnu.org; Wed, 05 Mar 2025 20:19:04 -0500 Received: from phl-compute-01.internal (phl-compute-01.phl.internal [10.202.2.41]) by mailfhigh.stl.internal (Postfix) with ESMTP id 6B1C8254011F; Wed, 5 Mar 2025 20:18:57 -0500 (EST) Received: from phl-mailfrontend-01 ([10.202.2.162]) by phl-compute-01.internal (MEProxy); Wed, 05 Mar 2025 20:18:57 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pub.pink; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1741223937; x=1741310337; bh=zd4dEhsa+hHW5L+yVEBEt7mrr9U5GX2axxCrxZCOYwU=; b= i2pOY1gtiE9ur6xdyQMfOwaduYwNQjzVc3pGGQL36P+pwF+0IcrkwVW8y6n4RLDH LtVWvoS8F+viIV4JJ+jUKxzofijdfq473lMnylM5MlszVQtYnBTzJoAm6olON7w6 I9CoS3JFBTKKuL5u+gy2m59qei42L3yJlW11gke6Tjvbqjfjj/PbRr8JJj+Qp8Zq aMbRc8e93ICIR9F7f14ddS2wXk9ylehMYY/rBSpqWRa4FFxp7Qqx9HOLaCC+0Vg6 eZeVamRL778elxDD5mtTmgZmx6zp9SQbIkwe1SlM3G5k6kzwkrhUE70YtLJwWqm3 ZVr1HB6lCO4Yoh9EjM8rFA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1741223937; x= 1741310337; bh=zd4dEhsa+hHW5L+yVEBEt7mrr9U5GX2axxCrxZCOYwU=; b=X ipYmCInnchzlsfzvHNoHva+oOehrqx7nBSsrilpoWQVaXC12g9qmIFrRkpep1M9K cfwcNsFa8Ky3suqHdxc8hxKyaE3nco5w+VvLpQD0xORP0fimp5RtX5JhGRhM9Qw9 wsyGQGZN178iYy8JCUKoGIJggz6BPNFbPYI+PWC5DscuwpLzGnCVYELo2V1qxfWg oMP7OMtQoYAxGazWMVq3IIwLDbfuyF0xAq5ayq6uU4tEKohHcW2Nd/ARKhyW1Xks nlEWON6IjRI/rG8dGjeMRViGYVwcIDplcSO0J3VidKa1BbWz6QjwdQW1DzfFQfKv +jNAHpz0dR3ivPHC4QDvw== X-ME-Sender: <xms:AfjIZ4CMxUmm0oB_Hph_gRp1cgWxFF6cTN5nZTlR8fsZ7EpkIvu00A> <xme:AfjIZ6juTbPzYVpLpbB42FXLZrTQs5EtGFUXZIATI3OO0fvrp1Px07WINwi_i5xSO n5R0uFX-RyYni8obXo> X-ME-Received: <xmr:AfjIZ7nl2Qa3_PyRvat_G5iGq3qNJTL9pLzIVqSzcJlpzTjfCvM4cQ> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddutdeifeekucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhepfhgfhffvvefuffgjkfggtgfgsehtqhertddt reejnecuhfhrohhmpehjohhhnhcumhhuhhhluceojhhmsehpuhgsrdhpihhnkheqnecugg ftrfgrthhtvghrnhepveefgfefieevtdefiedvieehjeeffeeludekgeeltefhuddtkeeh gedvgfefjeelnecuffhomhgrihhnpehgihhthhhusgdrtghomhdpshhrrdhhthenucevlh hushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehjmhesphhusgdr phhinhhkpdhnsggprhgtphhtthhopeegpdhmohguvgepshhmthhpohhuthdprhgtphhtth hopeejieeihedtseguvggssghughhsrdhgnhhurdhorhhgpdhrtghpthhtoheprggtohhr rghllhhosehgnhhurdhorhhgpdhrtghpthhtohepvghlihiisehgnhhurdhorhhgpdhrtg hpthhtohepshhtvghfrghnkhgrnhhgrghssehgmhgrihhlrdgtohhm X-ME-Proxy: <xmx:AfjIZ-xxmig_rqV1nDKrDhbYupdBhTGi2_-TQiHUVf-uVqCZtxfn0Q> <xmx:AfjIZ9RN8PU3beTlXyiN-pko2NE08aDGQzxtUtRP70Q3evquKzi2ig> <xmx:AfjIZ5Y3lLXIw-U-VegibN69OptIdOMqidMPkQcw4aU-dbqpUhDI9A> <xmx:AfjIZ2QA8j7FHNlcwo8KOp3NYdloWXZuqaVhXTzfGH4NKJ0pVXr-yQ> <xmx:AfjIZ7O31ersZCn85LE4o1UUA5R7y2JHy8AMqpikOZYvmRoy5BUWfp7b> Feedback-ID: i74194916:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 5 Mar 2025 20:18:56 -0500 (EST) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> <86senspow7.fsf@HIDDEN> <8734fs35bx.fsf@HIDDEN> <86jz93psm3.fsf@HIDDEN> <87plivh4d4.fsf@HIDDEN> <86jz93o3qq.fsf@HIDDEN> <87jz93fn5f.fsf@HIDDEN> <86h647nvty.fsf@HIDDEN> <CADwFkmk8Ua9e4f9tDv837MExLcvt4=RPtTvMpYwrtawztE358g@HIDDEN> User-agent: mu4e 1.10.8; emacs 31.0.50 From: john muhl <jm@HIDDEN> Date: Wed, 05 Mar 2025 19:09:25 -0600 In-reply-to: <CADwFkmk8Ua9e4f9tDv837MExLcvt4=RPtTvMpYwrtawztE358g@HIDDEN> Message-ID: <87ldtjvtvr.fsf@HIDDEN> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.7 (-) Stefan Kangas <stefankangas@HIDDEN> writes: > Eli Zaretskii <eliz@HIDDEN> writes: > >>> From: john muhl <jm@HIDDEN> >>> Cc: stefankangas@HIDDEN, acorallo@HIDDEN, 76650 <at> debbugs.gnu.org >>> Date: Wed, 05 Mar 2025 10:33:20 -0600 >>> >>> Then one last procedural question before I get started on that >>> initial commit. Do we want to preserve the git history or just >>> bring it in as if it were new file? >> >> It is best to preserve it. > > Indeed. This is one possible starting point: > https://gist.github.com/joaotavora/2ed97f2ec85958986983d5cb78202770 > > The idea is to put the changes on a separate branch containing only that > one file in its right location, and then to merge that to master. Ok. I have the history in a branch. https://git.sr.ht/~johnmuhl/emacs/log/scratch/lua-mode In the latest commit there I=E2=80=99ve gone through and marked all the lines remaining from the inital commit. Please correct me if I=E2=80=99m wrong but the only thing that looks possibly significant copyright-wise is the function =E2=80=98lua-end-of-proc=E2=80=99. Am I too optimistic? >>> If the former should the commit messages all be cleaned up to >>> conform to Emacs standards? >> >> Is that even practical? > > It's not necessary, and its impractical. The commit that merges to > master could have a ChangeLog entry like this: > > * lisp/progmodes/lua-mode.ts: New file. Great. I was not looking forward to that effort.
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: john muhl <jm@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Thu, 13 Mar 2025 22:18:01 +0000 Resent-Message-ID: <handler.76650.B76650.174190425915611 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: 76650 <at> debbugs.gnu.org Cc: Eli Zaretskii <eliz@HIDDEN>, acorallo@HIDDEN, Stefan Kangas <stefankangas@HIDDEN> Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.174190425915611 (code B ref 76650); Thu, 13 Mar 2025 22:18:01 +0000 Received: (at 76650) by debbugs.gnu.org; 13 Mar 2025 22:17:39 +0000 Received: from localhost ([127.0.0.1]:58658 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tsqrz-00043i-Bu for submit <at> debbugs.gnu.org; Thu, 13 Mar 2025 18:17:39 -0400 Received: from fhigh-a8-smtp.messagingengine.com ([103.168.172.159]:51917) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <jm@HIDDEN>) id 1tsqrs-00043M-Gc for 76650 <at> debbugs.gnu.org; Thu, 13 Mar 2025 18:17:36 -0400 Received: from phl-compute-03.internal (phl-compute-03.phl.internal [10.202.2.43]) by mailfhigh.phl.internal (Postfix) with ESMTP id 4EB631140158; Thu, 13 Mar 2025 18:17:27 -0400 (EDT) Received: from phl-mailfrontend-01 ([10.202.2.162]) by phl-compute-03.internal (MEProxy); Thu, 13 Mar 2025 18:17:27 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pub.pink; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1741904247; x=1741990647; bh=LXsg88fvX8ub+WtAa2gZfwxqBAYXqGyFWWaHaYPCKl4=; b= kAvNTC6wh3cOG1Rp16DIrund34+jUyExZFh0HSvrBBLqUX3hBGHvI65lnDtUnW7J jZmBNvYo2aVrv53Yi+lvlivLi8KbWr5rGdxKDNtVUGOM7ZJzqCAqOncKtypI3XEk 9e/79ZL8e1zGfa51Y0qPWE0ajSWAoJHzDY87UkQCN2O18cGqxEX1mJNAf/ArG+W6 aRNzFKHv7yKYlL+FCNQeWkWa1wJzkaEhpDapdcOnUoD1BBloVib9uZI7R16tlgBb ASfegiYAV5aPOGZwJY8LVDzWnyOVXJRarCiClGyQ74VB+l9i6vfoqxaaNBBOqA7Y oAfPsc2RGGLGYLtiRcnSLw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1741904247; x= 1741990647; bh=LXsg88fvX8ub+WtAa2gZfwxqBAYXqGyFWWaHaYPCKl4=; b=R RwyRh4V17XSmaXzhTAnSpQTFvGyBvQiJGZwMwkj+d5u78YrTnnryN+4vE9Irh6Sj kpfefNcKqMfXCNCRb6oYeAPWCikKttdQOx6G0b5FV2IqGBsxbmriYhI2A5Tq+60f tRwKV3gkfATZvV1lEpgSPsNpSjfXmJ3zk8tNznvpQr0j5EF3Usk12PzugZnl9h8L Gep3NvIlGjKcjlqgT+fvSh1lQAUGKaVPr076d7NMAUmvuLxy9Rc4SRZKRllofV5d tqQNBOXrKtX13H9Wfb8I9QjjHj3BV77gIWC7QiiygoiOLMbtOCZ/q/Bh20cNKOcD d//M48V7THU3FZWu4+JAg== X-ME-Sender: <xms:dlnTZ7QXiABD2_jAjV9JGvWdGHI-BKh_cCtNGj-Ne0vkWRw9CaJB5g> <xme:dlnTZ8zrI7nm6YTesdDLtDLxTOUDGCImeiZIqZ68-TKADrnPrNKupAICsyStJrKyC oqucFfuR6k21BHS0Q8> X-ME-Received: <xmr:dlnTZw0GlVla46Yl52iVpbOYaLEwZH6xtlTyaWf0KEXq7JMFZ43hNQ> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdduvdeludefucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhepfhgfhffvvefuffgjkfggtgfgsehtqhertddt reejnecuhfhrohhmpehjohhhnhcumhhuhhhluceojhhmsehpuhgsrdhpihhnkheqnecugg ftrfgrthhtvghrnhepveefgfefieevtdefiedvieehjeeffeeludekgeeltefhuddtkeeh gedvgfefjeelnecuffhomhgrihhnpehgihhthhhusgdrtghomhdpshhrrdhhthenucevlh hushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehjmhesphhusgdr phhinhhkpdhnsggprhgtphhtthhopeegpdhmohguvgepshhmthhpohhuthdprhgtphhtth hopegrtghorhgrlhhlohesghhnuhdrohhrghdprhgtphhtthhopegvlhhiiiesghhnuhdr ohhrghdprhgtphhtthhopehsthgvfhgrnhhkrghnghgrshesghhmrghilhdrtghomhdprh gtphhtthhopeejieeihedtseguvggssghughhsrdhgnhhurdhorhhg X-ME-Proxy: <xmx:dlnTZ7CtwiYqvbzw3C8eEFCq-eIkMqq2WPS5CjQFw-TO988pmHw_TA> <xmx:dlnTZ0jYc2MpoOoPoNFvaOEBvnGQ3VRDtY18lLup2025E3xQwmMYqQ> <xmx:dlnTZ_pi6r86LrqUxAn8_-_wa2Eg1FEwu2Vd6jHSu7xTes4-vFXcGA> <xmx:dlnTZ_hRzsjy8h4tSLddL9cj3kjYYTdjuASa5WnEiWgXHO-Ks6ySeA> <xmx:d1nTZ8cnSz23DyoMLdMeK-3zG2ljO2HbTgC9KTM7xxD6f_ImhQIFUm6x> Feedback-ID: i74194916:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Thu, 13 Mar 2025 18:17:26 -0400 (EDT) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> <86senspow7.fsf@HIDDEN> <8734fs35bx.fsf@HIDDEN> <86jz93psm3.fsf@HIDDEN> <87plivh4d4.fsf@HIDDEN> <86jz93o3qq.fsf@HIDDEN> <87jz93fn5f.fsf@HIDDEN> <86h647nvty.fsf@HIDDEN> <CADwFkmk8Ua9e4f9tDv837MExLcvt4=RPtTvMpYwrtawztE358g@HIDDEN> <87ldtjvtvr.fsf@HIDDEN> User-agent: mu4e 1.10.8; emacs 31.0.50 From: john muhl <jm@HIDDEN> Date: Thu, 13 Mar 2025 16:50:49 -0500 In-reply-to: <87ldtjvtvr.fsf@HIDDEN> Message-ID: <8734fglgng.fsf@HIDDEN> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.7 (-) john muhl <jm@HIDDEN> writes: > Stefan Kangas <stefankangas@HIDDEN> writes: > >> Eli Zaretskii <eliz@HIDDEN> writes: >> >>>> From: john muhl <jm@HIDDEN> >>>> Cc: stefankangas@HIDDEN, acorallo@HIDDEN, 76650 <at> debbugs.gnu.org >>>> Date: Wed, 05 Mar 2025 10:33:20 -0600 >>>> >>>> Then one last procedural question before I get started on that >>>> initial commit. Do we want to preserve the git history or just >>>> bring it in as if it were new file? >>> >>> It is best to preserve it. >> >> Indeed. This is one possible starting point: >> https://gist.github.com/joaotavora/2ed97f2ec85958986983d5cb78202770 >> >> The idea is to put the changes on a separate branch containing only that >> one file in its right location, and then to merge that to master. > > Ok. I have the history in a branch. > > https://git.sr.ht/~johnmuhl/emacs/log/scratch/lua-mode > > In the latest commit there I=E2=80=99ve gone through and marked all the > lines remaining from the inital commit. Please correct me if I=E2=80=99m > wrong but the only thing that looks possibly significant > copyright-wise is the function =E2=80=98lua-end-of-proc=E2=80=99. Am I too > optimistic? To update the progress here. I rewrote the lua-end-of-proc function and a few other places. That got us down to 160 lines from the original commit: https://git.sr.ht/~johnmuhl/emacs/tree/79db03ca/item/lisp/progmodes/lua-mod= e.el Going through that and unmarking comments, docstrings and lines of code that obviously fall short of copyright (e.g. save-excursion, trivial interactive forms, defuns, &c.) gets down to 28 lines: https://git.sr.ht/~johnmuhl/emacs/tree/8d44ba06/item/lisp/progmodes/lua-mod= e.el (search =E2=80=9C; 03e991=E2=80=9D to check what=E2=80=99s left) Of those none of them look to me like they=E2=80=99d qualify as original or substantial enough to matter.
X-Loop: help-debbugs@HIDDEN Subject: bug#76650: 31.0.50; Add lua-mode to Emacs Resent-From: john muhl <jm@HIDDEN> Original-Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> Resent-CC: bug-gnu-emacs@HIDDEN Resent-Date: Fri, 21 Mar 2025 17:44:02 +0000 Resent-Message-ID: <handler.76650.B76650.17425789899918 <at> debbugs.gnu.org> Resent-Sender: help-debbugs@HIDDEN X-GNU-PR-Message: followup 76650 X-GNU-PR-Package: emacs X-GNU-PR-Keywords: To: 76650 <at> debbugs.gnu.org Cc: Eli Zaretskii <eliz@HIDDEN>, acorallo@HIDDEN, Stefan Kangas <stefankangas@HIDDEN> Received: via spool by 76650-submit <at> debbugs.gnu.org id=B76650.17425789899918 (code B ref 76650); Fri, 21 Mar 2025 17:44:02 +0000 Received: (at 76650) by debbugs.gnu.org; 21 Mar 2025 17:43:09 +0000 Received: from localhost ([127.0.0.1]:39385 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1tvgOj-0002Zu-9K for submit <at> debbugs.gnu.org; Fri, 21 Mar 2025 13:43:09 -0400 Received: from fhigh-a3-smtp.messagingengine.com ([103.168.172.154]:38891) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.84_2) (envelope-from <jm@HIDDEN>) id 1tvgOh-0002ZN-3h for 76650 <at> debbugs.gnu.org; Fri, 21 Mar 2025 13:43:07 -0400 Received: from phl-compute-02.internal (phl-compute-02.phl.internal [10.202.2.42]) by mailfhigh.phl.internal (Postfix) with ESMTP id E5945114018C; Fri, 21 Mar 2025 13:43:01 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-02.internal (MEProxy); Fri, 21 Mar 2025 13:43:01 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pub.pink; h=cc :cc:content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm1; t=1742578981; x=1742665381; bh=2ecdgpLnwx f5TXAZsfog8N1oe80gz9Y+MPMrgXIiHUM=; b=ej/uSv7MZZ/M+T9FAwNpCSBCIy wGTUVk7dDqY8jdBH50I/RYfkFZtTjXqyVYAEBBZyGSBszLBojysDZF1RbSf6JCRm O+drWSgR3PJfslnBmly6De8+rBNYpCOI2tKYITJi+081sQ2G+r+xS83jFjjPRzoK Zj2dwt6VBUCONPQLOdFOL9+AtuQrwJI0lSG86liI/t5m6Dsjw+HjtP3VmM8Ob5gk TndNrUAiYS/5ms353OZZxBVUMcTHHsJbHIr1jiLsQOMJc0RqyaPyZdlvdIZJx/Fn HuDAIC/ebyJIwglcHajW9lYNvFjBaJQBo11qTS6763O10Uguj+5OX6WCwHsw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t= 1742578981; x=1742665381; bh=2ecdgpLnwxf5TXAZsfog8N1oe80gz9Y+MPM rgXIiHUM=; b=MeN0e24nk7dvY/LWhoZwzYTT317ksjHrgetSXfrIocfiZSBa+Ah oWOAcVKJ3PRs43WpiqLcvzkk0n0tD09D5NjhfX2BIf4AJR7IRwpoKShlOvnVL50M WhYcB0fSHyntGJ1lwo5aax+j8wNR2WOuyFJWI4kyOyYVQDOpKH9gtxRq9/Cd4XlU goJb1TC8xlYW19HE/RP99PQSuHKnPKEhHg9tGRrrteH3odnr/0FoV+6BChcz5lUR oLWrn6WvfycaV4NuDkuggReRm/a3mdUIE/9eP28mZYAxWvJRGqSIrYG5zjeLPmt2 bjXa+MGf0KcHcVkD7caxJeBWfl2a7kAQeIQ== X-ME-Sender: <xms:JaXdZ0H6o2elbHSDz2nZAE_FtE3IbNPq8_6rdAGAMHrYtdGA83cKJA> <xme:JaXdZ9UPis23ntKlbDTnh5QhQWAkKT7yIjCfyVjmXyUcJ-o6drRUNSICflXbC1Lzm ikBJEpDzLZc3NX5cws> X-ME-Received: <xmr:JaXdZ-JzvtOlzdSBgY4XpA91zd0kMvhR9gIYv5thTRPZrZaK0ZA_aA> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdduhedujedvucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpih gvnhhtshculddquddttddmnecujfgurhepfhgfhffvvefuffgjkfggtgesmhdtreertder jeenucfhrhhomhepjhhohhhnuchmuhhhlhcuoehjmhesphhusgdrphhinhhkqeenucggtf frrghtthgvrhhnpefgjeevfeelhfelleehieeiveeuudfhvedvhfetgeffheffkedukeet ueejffeuhfenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhroh hmpehjmhesphhusgdrphhinhhkpdhnsggprhgtphhtthhopeegpdhmohguvgepshhmthhp ohhuthdprhgtphhtthhopegrtghorhgrlhhlohesghhnuhdrohhrghdprhgtphhtthhope gvlhhiiiesghhnuhdrohhrghdprhgtphhtthhopehsthgvfhgrnhhkrghnghgrshesghhm rghilhdrtghomhdprhgtphhtthhopeejieeihedtseguvggssghughhsrdhgnhhurdhorh hg X-ME-Proxy: <xmx:JaXdZ2HPb1mafGNoAl-CJOmd2JOmue87IFdjGTu69WJl1Df78zbl0Q> <xmx:JaXdZ6U2nBCuuVPtQCOAttnGUfTVDFc4M_IkxaozJk1yE2EXYL_AGQ> <xmx:JaXdZ5MenmIk2w77MqYIO5W3ZT2f9LGx3nLzAhvbJLsDemxKWEzrGw> <xmx:JaXdZx2o7CiK9icmJ1vj3zvBH9RIWfI7Oil2cawQLtemBvgyR8vDQA> <xmx:JaXdZ4w9Dud69hW85giZ35OG2z21a_6eVBD0u4PVbgfTlWA3o_XhDf0R> Feedback-ID: i74194916:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Fri, 21 Mar 2025 13:43:00 -0400 (EDT) References: <87mse6ufwd.fsf@HIDDEN> <CADwFkmnxJ0n81c5aC5fgTfpoLzzUM1Lrem-cxr1jQcibT=zh5g@HIDDEN> <87frjs6314.fsf@HIDDEN> <86senspow7.fsf@HIDDEN> <8734fs35bx.fsf@HIDDEN> <86jz93psm3.fsf@HIDDEN> <87plivh4d4.fsf@HIDDEN> <86jz93o3qq.fsf@HIDDEN> <87jz93fn5f.fsf@HIDDEN> <86h647nvty.fsf@HIDDEN> <CADwFkmk8Ua9e4f9tDv837MExLcvt4=RPtTvMpYwrtawztE358g@HIDDEN> <87ldtjvtvr.fsf@HIDDEN> <8734fglgng.fsf@HIDDEN> User-agent: mu4e 1.10.8; emacs 31.0.50 From: john muhl <jm@HIDDEN> Date: Fri, 21 Mar 2025 12:31:18 -0500 In-reply-to: <8734fglgng.fsf@HIDDEN> Message-ID: <87r02q8eld.fsf@HIDDEN> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="=-=-=" X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable I think we=E2=80=99re close now. The attached patch should be ready to install or at least review. Use of advice has been removed, byte-compiler and checkdoc warnings are fixed and tests have been added. For the tests I just copied the lua-ts-mode files and adjusted for the current state of lua-mode. Once landed I=E2=80=99ll follow up with some improvements and work out how to share code between the Lua modes (following the Ruby model unless there is some other preference). --=-=-= Content-Type: text/x-patch Content-Disposition: attachment; filename=0001-Add-lua-mode.patch From 096b75c5c2fcb7c799814ba707660589f749cdc4 Mon Sep 17 00:00:00 2001 From: john muhl <jm@HIDDEN> Date: Fri, 21 Mar 2025 12:24:40 -0500 Subject: [PATCH] Add 'lua-mode' (Bug#76650) * lisp/progmodes/lua-mode.el: * test/lisp/progmodes/lua-mode-resources/font-lock.lua: * test/lisp/progmodes/lua-mode-resources/hide-show.lua: * test/lisp/progmodes/lua-mode-resources/indent.erts: * test/lisp/progmodes/lua-mode-resources/movement.erts: * test/lisp/progmodes/lua-mode-resources/which-function.lua: * test/lisp/progmodes/lua-mode-tests.el: New file. --- etc/NEWS | 3 + lisp/progmodes/lua-mode.el | 2104 +++++++++++++++++ .../lua-mode-resources/font-lock.lua | 184 ++ .../lua-mode-resources/hide-show.lua | 35 + .../progmodes/lua-mode-resources/indent.erts | 1061 +++++++++ .../lua-mode-resources/movement.erts | 637 +++++ .../lua-mode-resources/which-function.lua | 3 + test/lisp/progmodes/lua-mode-tests.el | 60 + 8 files changed, 4087 insertions(+) create mode 100644 lisp/progmodes/lua-mode.el create mode 100644 test/lisp/progmodes/lua-mode-resources/font-lock.lua create mode 100644 test/lisp/progmodes/lua-mode-resources/hide-show.lua create mode 100644 test/lisp/progmodes/lua-mode-resources/indent.erts create mode 100644 test/lisp/progmodes/lua-mode-resources/movement.erts create mode 100644 test/lisp/progmodes/lua-mode-resources/which-function.lua create mode 100644 test/lisp/progmodes/lua-mode-tests.el diff --git a/etc/NEWS b/etc/NEWS index cc63d03eafe..7caf5932404 100644 --- a/etc/NEWS +++ b/etc/NEWS @@ -1619,6 +1619,9 @@ A major mode based on the tree-sitter library for editing "go.work" files. If tree-sitter is properly set-up by the user, it can be enabled for files named "go.work". +** New package 'lua-mode'. +The 'lua-mode' package from Non-GNU ELPA is now included in Emacs. + * Incompatible Lisp Changes in Emacs 31.1 diff --git a/lisp/progmodes/lua-mode.el b/lisp/progmodes/lua-mode.el new file mode 100644 index 00000000000..d5d1d651e3b --- /dev/null +++ b/lisp/progmodes/lua-mode.el @@ -0,0 +1,2104 @@ +;;; lua-mode.el --- Major-mode for editing Lua files -*- lexical-binding: t -*- + +;; Copyright (C) 2025 Free Software Foundation, Inc. + +;; Author: 2011-2013 immerrr <immerrr+lua@HIDDEN> +;; 2010-2011 Reuben Thomas <rrt@HIDDEN> +;; 2006 Juergen Hoetzel <juergen@HIDDEN> +;; 2004 various (support for Lua 5 and byte compilation) +;; 2001 Christian Vogler <cvogler@HIDDEN> +;; 1997 Bret Mogilefsky <mogul-lua@HIDDEN> starting from +;; tcl-mode by Gregor Schmid <schmid@HIDDEN> +;; with tons of assistance from +;; Paul Du Bois <pld-lua@HIDDEN> and +;; Aaron Smith <aaron-lua@HIDDEN>. +;; +;; Keywords: languages, processes, tools + +;; This file is part of GNU Emacs. + +;; GNU Emacs is free software: you can redistribute it and/or modify +;; it under the terms of the GNU General Public License as published by +;; the Free Software Foundation, either version 3 of the License, or +;; (at your option) any later version. +;; +;; GNU Emacs is distributed in the hope that it will be useful, +;; but WITHOUT ANY WARRANTY; without even the implied warranty of +;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;; GNU General Public License for more details. +;; +;; You should have received a copy of the GNU General Public License +;; along with GNU Emacs. If not, see <https://www.gnu.org/licenses/>. + +;;; Commentary: + +;; lua-mode provides support for editing Lua, including automatic +;; indentation, syntactical font-locking, running interactive shell, +;; Flymake checks with luacheck, interacting with `hs-minor-mode' and +;; online documentation lookup. +;; +;; The following variables are available for customization (see more via +;; `M-x customize-group lua`): +;; +;; - Var `lua-indent-level': +;; indentation offset in spaces +;; - Var `lua-indent-string-contents': +;; set to `t` if you like to have contents of multiline strings to be +;; indented like comments +;; - Var `lua-indent-nested-block-content-align': +;; set to `nil' to stop aligning the content of nested blocks with the +;; open parenthesis +;; - Var `lua-indent-close-paren-align': +;; set to `t' to align close parenthesis with the open parenthesis, +;; rather than with the beginning of the line +;; - Var `lua-mode-hook': +;; list of functions to execute when lua-mode is initialized +;; - Var `lua-documentation-url': +;; base URL for documentation lookup +;; - Var `lua-documentation-function': function used to +;; show documentation (`eww` is a viable alternative for Emacs 25) +;; +;; These are variables/commands that operate on the Lua process: +;; +;; - Var `lua-default-application': +;; command to start the Lua process (REPL) +;; - Var `lua-default-command-switches': +;; arguments to pass to the Lua process on startup (make sure `-i` is +;; there if you expect working with Lua shell interactively) +;; - Cmd `lua-start-process': start new REPL process, usually happens +;; automatically +;; - Cmd `lua-kill-process': kill current REPL process +;; +;; These are variables/commands for interaction with the Lua process: +;; +;; - Cmd `lua-show-process-buffer': switch to REPL buffer +;; - Cmd `lua-hide-process-buffer': hide window showing REPL buffer +;; - Var `lua-always-show': show REPL buffer after sending something +;; - Cmd `lua-send-buffer': send whole buffer +;; - Cmd `lua-send-current-line': send current line +;; - Cmd `lua-send-defun': send current top-level function +;; - Cmd `lua-send-region': send active region +;; - Cmd `lua-restart-with-whole-file': restart REPL and send whole buffer +;; +;; To enable on-the-fly linting, make sure you have the luacheck program +;; installed (available from luarocks) and activate `flymake-mode'. +;; +;; See "M-x apropos-command ^lua-" for a list of commands. +;; See "M-x customize-group lua" for a list of customizable variables. + +;;; Code: + +(require 'comint) +(require 'newcomment) +(require 'rx) + +(eval-when-compile + (require 'cl-lib) + (require 'compile)) + +;; rx-wrappers for Lua + +(eval-and-compile + (defvar lua--rx-bindings + '((symbol (&rest x) (seq symbol-start (or x) symbol-end)) + (ws (* (any " \t"))) + (ws+ (+ (any " \t"))) + + (lua-name (symbol (seq (+ (any alpha "_")) (* (any alnum "_"))))) + (lua-funcname (seq lua-name (* ws "." ws lua-name) + (opt ws ":" ws lua-name))) + (lua-funcheader + ;; Outer (seq ...) is here to shy-group the definition + (seq (or (seq (symbol "function") ws (group-n 1 lua-funcname)) + (seq (group-n 1 lua-funcname) ws "=" ws + (symbol "function"))))) + (lua-number + (seq (or (seq (+ digit) (opt ".") (* digit)) + (seq (* digit) (opt ".") (+ digit))) + (opt (regexp "[eE][+-]?[0-9]+")))) + (lua-assignment-op (seq "=" (or buffer-end (not (any "="))))) + (lua-operator (or "+" "-" "*" "/" "%" "^" "#" "==" "~=" "<=" ">=" "<" + ">" "=" ";" ":" "," "." ".." "...")) + (lua-keyword-operator (symbol "and" "not" "or")) + (lua-keyword + (symbol "break" "do" "else" "elseif" "end" "for" "function" + "goto" "if" "in" "local" "repeat" "return" + "then" "until" "while")) + (lua-up-to-9-variables + (seq (group-n 1 lua-name) ws + (? "," ws (group-n 2 lua-name) ws + (? "," ws (group-n 3 lua-name) ws + (? "," ws (group-n 4 lua-name) ws + (? "," ws (group-n 5 lua-name) ws + (? "," ws (group-n 6 lua-name) ws + (? "," ws (group-n 7 lua-name) ws + (? "," ws (group-n 8 lua-name) ws + (? "," ws (group-n 9 lua-name) ws)))))))))))) + + (defmacro lua-rx (&rest regexps) + (eval `(rx-let ,lua--rx-bindings + (rx ,@regexps)))) + + (defun lua-rx-to-string (form &optional no-group) + (rx-let-eval lua--rx-bindings + (rx-to-string form no-group)))) + +;; Local variables + +(defgroup lua nil + "Major mode for editing Lua code." + :prefix "lua-" + :group 'languages) + +(defcustom lua-indent-level 3 + "Amount by which Lua subexpressions are indented." + :type 'integer + :safe #'integerp + :version "31.1") + +(defcustom lua-comment-start "-- " + "Default value of `comment-start'." + :type 'string + :version "31.1") + +(defcustom lua-comment-start-skip "---*[ \t]*" + "Default value of `comment-start-skip'." + :type 'string + :version "31.1") + +(defcustom lua-default-application "lua" + "Default application to run in Lua process. + +Can be a string, where it denotes a command to be executed to start Lua +process, or a (HOST . PORT) cons, that can be used to connect to Lua +process running remotely." + :type '(choice (string) + (cons string integer)) + :version "31.1") + +(defcustom lua-default-command-switches (list "-i") + "Command switches for `lua-default-application'. +Should be a list of strings." + :type '(repeat string) + :version "31.1") + +(defcustom lua-always-show t + "Non-nil means display lua-process-buffer after sending a command." + :type 'boolean + :version "31.1") + +(defcustom lua-documentation-function 'browse-url + "Function used to fetch the Lua reference manual." + :type `(radio (function-item browse-url) + ,@(when (fboundp 'eww) '((function-item eww))) + ,@(when (fboundp 'w3m-browse-url) + '((function-item w3m-browse-url))) + (function :tag "Other function")) + :version "31.1") + +(defcustom lua-documentation-url + (or (and (file-readable-p "/usr/share/doc/lua/manual.html") + "file:///usr/share/doc/lua/manual.html") + "http://www.lua.org/manual/5.1/manual.html") + "URL pointing to the Lua reference manual." + :type 'string + :version "31.1") + +(defvar lua-process nil + "The active Lua process.") + +(defvar lua-process-buffer nil + "Buffer used for communication with the Lua process.") + +(defun lua--customize-set-prefix-key (prefix-key-sym prefix-key-val) + "Set PREFIX-KEY-SYM to PREFIX-KEY-VAL." + (unless (eq prefix-key-sym 'lua-prefix-key) + (error "Prefix doesn't match lua-prefix-key")) + (set prefix-key-sym (when (and prefix-key-val (> (length prefix-key-val) 0)) + ;; read-kbd-macro returns a string or a vector + ;; in both cases (elt x 0) is ok + (elt (read-kbd-macro prefix-key-val) 0))) + (when (fboundp 'lua-prefix-key-update-bindings) + (lua-prefix-key-update-bindings))) + +(defcustom lua-prefix-key "\C-c" + "Prefix for all `lua-mode' commands." + :type 'string + :set 'lua--customize-set-prefix-key + :get (lambda (sym) + (if-let* ((val (eval sym))) (single-key-description val) "")) + :version "31.1") + +(defvar lua-prefix-mode-map + (eval-when-compile + (let ((result-map (make-sparse-keymap))) + (mapc (lambda (key_defn) + (define-key + result-map (read-kbd-macro (car key_defn)) (cdr key_defn))) + '(("C-l" . lua-send-buffer) + ("C-f" . lua-search-documentation))) + result-map)) + "Keymap that is used to define keys accessible by `lua-prefix-key'. + +If the latter is nil, the keymap translates into `lua-mode-map' verbatim.") + +(defvar lua--electric-indent-chars + (mapcar #'string-to-char '("}" "]" ")"))) + +(defvar lua-mode-map + (let ((result-map (make-sparse-keymap))) + (unless (boundp 'electric-indent-chars) + (mapc (lambda (electric-char) + (define-key result-map + (read-kbd-macro + (char-to-string electric-char)) + #'lua-electric-match)) + lua--electric-indent-chars)) + (define-key result-map [remap backward-up-list] 'lua-backward-up-list) + + ;; Handle prefix-keyed bindings: + ;; * if no prefix, set prefix-map as parent, i.e. if key is not + ;; defined look it up in prefix-map + ;; * if prefix is set, bind the prefix-map to that key + (if lua-prefix-key + (define-key result-map (vector lua-prefix-key) lua-prefix-mode-map) + (set-keymap-parent result-map lua-prefix-mode-map)) + result-map) + "Keymap used in `lua-mode' buffers.") + +(defvar-local lua-electric-flag t + "Non-nil means electric actions are enabled.") + +(defcustom lua-prompt-regexp "[^\n]*\\(>[\t ]+\\)+$" + "Regexp which matches the Lua program's prompt." + :type 'regexp + :version "31.1") + +(defvar-local lua--repl-buffer-p nil + "Buffer-local flag saying if this is a Lua REPL buffer.") + +(defcustom lua-indent-string-contents nil + "If non-nil, contents of multiline string will be indented. +Otherwise leading amount of whitespace on each line is preserved." + :type 'boolean + :safe #'booleanp + :version "31.1") + +(defcustom lua-indent-nested-block-content-align t + "Controls how the content of nested blocks are indented. +If non-nil, the contents of nested blocks are indented to align with the +column of the opening parenthesis, rather than just forward by +`lua-indent-level'." + :type 'boolean + :safe #'booleanp + :version "31.1") + +(defcustom lua-indent-close-paren-align t + "Controls how closing parenthesis is aligned. +If non-nil, close parenthesis are aligned with their open parenthesis. +If nil, close parenthesis are aligned to the beginning of the line." + :type 'boolean + :safe #'booleanp + :version "31.1") + +(defcustom lua-jump-on-traceback t + "Jump to innermost traceback location in *lua* buffer. +When this variable is non-nil and a traceback occurs when running Lua +code in a process, jump immediately to the source code of the innermost +traceback location." + :type 'boolean + :version "31.1") + +(defcustom lua-mode-hook nil + "Hooks called when Lua mode fires up." + :type 'hook + :options '(eglot-ensure + flymake-mode + hs-minor-mode + outline-minor-mode) + :version "31.1") + +(defvar lua-region-start (make-marker) + "Start of special region for Lua communication.") + +(defvar lua-region-end (make-marker) + "End of special region for Lua communication.") + +;; The whole defconst is inside eval-when-compile, because it's later +;; referenced inside another eval-and-compile block. +(eval-and-compile + (defconst lua--builtins + (let* ((modules + '("_G" "_VERSION" "assert" "collectgarbage" "dofile" "error" "getfenv" + "getmetatable" "ipairs" "load" "loadfile" "loadstring" "module" + "next" "pairs" "pcall" "print" "rawequal" "rawget" "rawlen" "rawset" + "require" "select" "setfenv" "setmetatable" "tonumber" "tostring" + "type" "unpack" "xpcall" "self" "warn" + ("bit32" . ("arshift" "band" "bnot" "bor" "btest" "bxor" "extract" + "lrotate" "lshift" "replace" "rrotate" "rshift")) + ("coroutine" . ("create" "isyieldable" "resume" "running" "status" + "wrap" "yield")) + ("debug" . ("debug" "getfenv" "gethook" "getinfo" "getlocal" + "getmetatable" "getregistry" "getupvalue" "getuservalue" + "setfenv" "sethook" "setlocal" "setmetatable" + "setupvalue" "setuservalue" "traceback" "upvalueid" + "upvaluejoin")) + ("io" . ("close" "flush" "input" "lines" "open" "output" "popen" + "read" "stderr" "stdin" "stdout" "tmpfile" "type" "write")) + ("math" . ("abs" "acos" "asin" "atan" "atan2" "ceil" "cos" "cosh" + "deg" "exp" "floor" "fmod" "frexp" "huge" "ldexp" "log" + "log10" "max" "maxinteger" "min" "mininteger" "modf" "pi" + "pow" "rad" "random" "randomseed" "sin" "sinh" "sqrt" + "tan" "tanh" "tointeger" "type" "ult")) + ("os" . ("clock" "date" "difftime" "execute" "exit" "getenv" + "remove" "rename" "setlocale" "time" "tmpname")) + ("package" . ("config" "cpath" "loaded" "loaders" "loadlib" "path" + "preload" "searchers" "searchpath" "seeall")) + ("string" . ("byte" "char" "dump" "find" "format" "gmatch" "gsub" + "len" "lower" "match" "pack" "packsize" "rep" "reverse" + "sub" "unpack" "upper")) + ("table" . ("concat" "insert" "maxn" "move" "pack" "remove" "sort" + "unpack")) + ("utf8" . ("char" "charpattern" "codepoint" "codes" "len" + "offset"))))) + + (cl-labels + ((module-name-re (x) + (concat "\\(?1:\\_<" + (if (listp x) (car x) x) + "\\_>\\)")) + (module-members-re (x) + (if (listp x) + (concat "\\(?:[ \t]*\\.[ \t]*" + "\\_<\\(?2:" + (regexp-opt (cdr x)) + "\\)\\_>\\)?") + ""))) + + (concat + ;; Common prefix: + ;; - beginning-of-line + ;; - or neither of [ '.', ':' ] to exclude "foo.string.rep" + ;; - or concatenation operator ".." + "\\(?:^\\|[^:. \t]\\|[.][.]\\)" + ;; Optional whitespace + "[ \t]*" + "\\(?:" + ;; Any of modules/functions + (mapconcat (lambda (x) + (concat (module-name-re x) (module-members-re x))) + modules + "\\|") + "\\)")))) + "A regexp that matches Lua builtin functions & variables. + +This is a compilation of 5.1, 5.2 and 5.3 builtins taken from the +index of respective Lua reference manuals.") + +(defvar lua-font-lock-keywords + `(;; Highlight the hash-bang line "#!/foo/bar/lua" as comment + ("^#!.*$" . font-lock-comment-face) + + ;; Builtin constants + (,(lua-rx (symbol "true" "false" "nil")) + . font-lock-constant-face) + + ;; Keywords + (,(lua-rx (or lua-keyword lua-keyword-operator)) + . font-lock-keyword-face) + + ;; Labels used by the "goto" statement + ;; Highlights the following syntax: ::label:: + (,(lua-rx "::" ws lua-name ws "::") + . font-lock-constant-face) + + ;; Highlights the name of the label in the "goto" statement like + ;; "goto label" + (,(lua-rx (symbol (seq "goto" ws+ (group-n 1 lua-name)))) + (1 font-lock-constant-face)) + + ;; Highlight Lua builtin functions and variables + (,lua--builtins + (1 font-lock-builtin-face) (2 font-lock-builtin-face nil noerror)) + + (,(lua-rx (symbol "for") ws+ lua-up-to-9-variables) + (1 font-lock-variable-name-face) + (2 font-lock-variable-name-face nil noerror) + (3 font-lock-variable-name-face nil noerror) + (4 font-lock-variable-name-face nil noerror) + (5 font-lock-variable-name-face nil noerror) + (6 font-lock-variable-name-face nil noerror) + (7 font-lock-variable-name-face nil noerror) + (8 font-lock-variable-name-face nil noerror) + (9 font-lock-variable-name-face nil noerror)) + + (,(lua-rx (symbol "function") (? ws+ lua-funcname) + ws "(" ws lua-up-to-9-variables) + (1 font-lock-variable-name-face) + (2 font-lock-variable-name-face nil noerror) + (3 font-lock-variable-name-face nil noerror) + (4 font-lock-variable-name-face nil noerror) + (5 font-lock-variable-name-face nil noerror) + (6 font-lock-variable-name-face nil noerror) + (7 font-lock-variable-name-face nil noerror) + (8 font-lock-variable-name-face nil noerror) + (9 font-lock-variable-name-face nil noerror)) + + (,(lua-rx lua-funcheader) + (1 font-lock-function-name-face)) + + ;; local x, y, z + ;; local x = ..... + ;; + ;; NOTE: this is intentionally below funcheader matcher, so that in + ;; + ;; local foo = function() ... + ;; + ;; "foo" is fontified as function-name-face, and variable-name-face + ;; is not applied. + (,(lua-rx (symbol "local") ws+ lua-up-to-9-variables) + (1 font-lock-variable-name-face) + (2 font-lock-variable-name-face nil noerror) + (3 font-lock-variable-name-face nil noerror) + (4 font-lock-variable-name-face nil noerror) + (5 font-lock-variable-name-face nil noerror) + (6 font-lock-variable-name-face nil noerror) + (7 font-lock-variable-name-face nil noerror) + (8 font-lock-variable-name-face nil noerror) + (9 font-lock-variable-name-face nil noerror)) + + (,(lua-rx (or (group-n 1 + "@" (symbol "author" "copyright" "field" "release" + "return" "see" "usage" "description")) + (seq (group-n 1 "@" (symbol "param" "class" "name")) ws+ + (group-n 2 lua-name)))) + (1 font-lock-keyword-face t) + (2 font-lock-variable-name-face t noerror))) + "Default expressions to highlight in Lua mode.") + +(defvar lua-imenu-generic-expression + `(("Requires" ,(lua-rx (or bol ";") ws (opt (seq (symbol "local") ws)) + (group-n 1 lua-name) ws "=" ws (symbol "require")) + 1) + (nil ,(lua-rx (or bol ";") ws (opt (seq (symbol "local") ws)) + lua-funcheader) + 1)) + "Imenu generic expression for `lua-mode'. +See `imenu-generic-expression'.") + +(defvar lua-sexp-alist '(("then" . "end") + ("function" . "end") + ("do" . "end") + ("repeat" . "until"))) + +(defvar lua-mode-abbrev-table nil + "Abbreviation table used in `lua-mode' buffers.") + +(define-abbrev-table 'lua-mode-abbrev-table + '(("end" "end" lua-indent-line :system t) + ("else" "else" lua-indent-line :system t) + ("elseif" "elseif" lua-indent-line :system t))) + +(defvar lua-mode-syntax-table + (with-syntax-table (copy-syntax-table) + ;; Main comment syntax: begins with "--", ends with "\n" + (modify-syntax-entry ?- ". 12") + (modify-syntax-entry ?\n ">") + + ;; Main string syntax: bounded by ' or " + (modify-syntax-entry ?\' "\"") + (modify-syntax-entry ?\" "\"") + + ;; Single-character binary operators: punctuation + (modify-syntax-entry ?+ ".") + (modify-syntax-entry ?* ".") + (modify-syntax-entry ?/ ".") + (modify-syntax-entry ?^ ".") + (modify-syntax-entry ?% ".") + (modify-syntax-entry ?> ".") + (modify-syntax-entry ?< ".") + (modify-syntax-entry ?= ".") + (modify-syntax-entry ?~ ".") + + (syntax-table)) + "`lua-mode' syntax table.") + +;;;###autoload +(define-derived-mode lua-mode prog-mode "Lua" + "Major mode for editing Lua code." + :abbrev-table lua-mode-abbrev-table + :syntax-table lua-mode-syntax-table + (setq-local font-lock-defaults '(lua-font-lock-keywords ; keywords + nil ; keywords-only + nil ; case-fold + nil ; syntax-alist + nil)) ; syntax-begin + + (setq-local syntax-propertize-function + 'lua--propertize-multiline-bounds) + + (setq-local parse-sexp-lookup-properties t) + (setq-local indent-line-function 'lua-indent-line) + (setq-local beginning-of-defun-function 'lua-beginning-of-proc) + (setq-local end-of-defun-function 'lua-end-of-proc) + (setq-local comment-start lua-comment-start) + (setq-local comment-start-skip lua-comment-start-skip) + (setq-local comment-use-syntax t) + (setq-local fill-paragraph-function #'lua--fill-paragraph) + (with-no-warnings + (setq-local comment-use-global-state t)) + (setq-local imenu-generic-expression lua-imenu-generic-expression) + (when (boundp 'electric-indent-chars) + ;; If electric-indent-chars is not defined, electric indentation is + ;; done via `lua-mode-map'. + (setq-local electric-indent-chars + (append electric-indent-chars lua--electric-indent-chars))) + (add-hook 'flymake-diagnostic-functions #'lua-flymake nil t) + + ;; Hide-show setup + (unless (assq 'lua-mode hs-special-modes-alist) + (add-to-list 'hs-special-modes-alist + `(lua-mode + ,(regexp-opt (mapcar 'car lua-sexp-alist) 'words) ; Start + ,(regexp-opt (mapcar 'cdr lua-sexp-alist) 'words) ; End + nil lua-forward-sexp)))) + +;;;###autoload +(add-to-list 'auto-mode-alist '("\\.lua\\'" . lua-mode)) + +;;;###autoload +(add-to-list 'interpreter-mode-alist '("lua" . lua-mode)) + +(defun lua-electric-match (arg) + "Insert character ARG and adjust indentation." + (interactive "P") + (let (blink-paren-function) + (self-insert-command (prefix-numeric-value arg))) + (when lua-electric-flag + (lua-indent-line)) + (blink-matching-open)) + +;; Private functions + +(defun lua--fill-paragraph (&optional justify region) + "Implementation of `forward-paragraph' for filling. + +This function works around a corner case in the following situations: + + <> + -- some very long comment .... + some_code_right_after_the_comment + +If point is at the beginning of the comment line, fill paragraph code +would have gone for comment-based filling and done the right thing, but +it does not find a comment at the beginning of the empty line before the +comment and falls back to text-based filling ignoring `comment-start' +and spilling the comment into the code. + +The arguments JUSTIFY and REGION control `fill-paragraph' (which see)." + (save-excursion + (while (and (not (eobp)) + (progn (move-to-left-margin) + (looking-at paragraph-separate))) + (forward-line 1)) + (let ((fill-paragraph-handle-comment t)) + (fill-paragraph justify region)))) + +(defun lua-prefix-key-update-bindings () + "Update prefix key bindings." + (if (eq lua-prefix-mode-map (keymap-parent lua-mode-map)) + ;; If prefix-map is a parent, delete the parent + (set-keymap-parent lua-mode-map nil) + ;; Otherwise, look for it among children + (when-let* ((old-cons (rassoc lua-prefix-mode-map lua-mode-map))) + (delq old-cons lua-mode-map))) + (if (null lua-prefix-key) + (set-keymap-parent lua-mode-map lua-prefix-mode-map) + (define-key lua-mode-map (vector lua-prefix-key) lua-prefix-mode-map))) + +(defun lua-set-prefix-key (new-key-str) + "Change `lua-prefix-key' to NEW-KEY-STR and update keymaps. + +This function replaces previous prefix-key binding with a new one." + (interactive "sNew prefix key (empty string means no key): ") + (lua--customize-set-prefix-key 'lua-prefix-key new-key-str) + (message "Prefix key set to %S" (single-key-description lua-prefix-key)) + (lua-prefix-key-update-bindings)) + +(defun lua-string-p (&optional pos) + "Return non-nil if point or POS is in a string." + (save-excursion (elt (syntax-ppss pos) 3))) + +(defun lua--containing-double-hyphen-start-pos () + "Return position of the beginning comment delimiter (--). + +Emacs syntax framework does not consider comment delimiters as +part of the comment itself, but for this package it is useful to +consider point as inside comment when it is between the two hyphens" + (and (eql (char-before) ?-) + (eql (char-after) ?-) + (1- (point)))) + +(defun lua-comment-start-pos (&optional parsing-state) + "Return position of comment containing current point. + +If point is not inside a comment, return nil. + +The argument PARSING-STATE is a `syntax-ppss' state." + (if-let* ((parsing-state (or parsing-state (syntax-ppss))) + ((not (nth 3 parsing-state))) ; Not a string. + ((nth 4 parsing-state))) ; Syntax-based comment. + (nth 8 parsing-state) + (lua--containing-double-hyphen-start-pos))) + +(defun lua-comment-or-string-p (&optional pos) + "Return non-nil if point or POS is in a comment or string." + (save-excursion + (let ((parse-result (syntax-ppss pos))) + (or (elt parse-result 3) (lua-comment-start-pos parse-result))))) + +(defun lua-comment-or-string-start-pos (&optional pos) + "Return start position of string or comment containing point or POS. + +If point is not inside string or comment, return nil." + (save-excursion + (when pos (goto-char pos)) + (or (elt (syntax-ppss pos) 8) + (lua--containing-double-hyphen-start-pos)))) + +;; They're propertized as follows: +;; 1. generic-comment +;; 2. generic-string +;; 3. equals signs +(defconst lua-ml-begin-regexp + "\\(?:\\(?1:-\\)-\\[\\|\\(?2:\\[\\)\\)\\(?3:=*\\)\\[") + +(defun lua-try-match-multiline-end (end) + "Try to match close-bracket for multiline literal around point. + +Basically, detect form of close bracket from syntactic information +provided at point and `re-search-forward' to it. + +The argument END is a buffer position that bounds the search." + (let ((comment-or-string-start-pos (lua-comment-or-string-start-pos))) + ;; Is there a literal around point? + (and comment-or-string-start-pos + ;; It is, check if the literal is a multiline open-bracket + (save-excursion + (goto-char comment-or-string-start-pos) + (looking-at lua-ml-begin-regexp)) + + ;; Yes it is, look for it matching close-bracket. Close + ;; bracket's match group is determined by match-group of + ;; open-bracket. + (re-search-forward + (format "]%s\\(?%s:]\\)" + (match-string-no-properties 3) + (if (match-beginning 1) 1 2)) + end 'noerror)))) + +(defun lua-try-match-multiline-begin (limit) + "Try to match multiline open-brackets. + +Find next opening long bracket outside of any string/comment. If none +can be found before reaching LIMIT, return nil." + (let (last-search-matched) + (while + ;; This loop will iterate skipping all multiline-begin tokens + ;; that are inside strings or comments ending either at EOL or + ;; at valid token. + (and (setq last-search-matched + (re-search-forward lua-ml-begin-regexp limit 'noerror)) + ;; Ensure --[[ is not inside a comment or string. + ;; + ;; This includes "---[[" sequence, in which "--" at the + ;; beginning creates a single-line comment, and thus "-[[" + ;; is no longer a multi-line opener. + ;; + ;; XXX: need to ensure syntax-ppss beyond (match-beginning + ;; 0) is not calculated, or otherwise we'll need to flush + ;; the cache. + (lua-comment-or-string-start-pos (match-beginning 0)))) + + last-search-matched)) + +(defun lua-match-multiline-literal-bounds (limit) + "Move point to multi-line literal bound. +The argument LIMIT is a buffer position that bounds the search." + ;; First, close any multiline literal spanning from previous block. + ;; This will move the point accordingly so as to avoid double + ;; traversal. + (or (lua-try-match-multiline-end limit) + (lua-try-match-multiline-begin limit))) + +(defun lua--propertize-multiline-bounds (start end) + "Put text properties on multiline literal bounds within START and END. + +Intended to be used as a `syntax-propertize-function'." + (save-excursion + (goto-char start) + (while (lua-match-multiline-literal-bounds end) + (when (match-beginning 1) + (put-text-property (match-beginning 1) (match-end 1) + 'syntax-table (string-to-syntax "!"))) + (when (match-beginning 2) + (put-text-property (match-beginning 2) (match-end 2) + 'syntax-table (string-to-syntax "|")))))) + +(defun lua-indent-line () + "Indent current line for Lua mode. +Return the amount the indentation changed by." + (let (indent + (case-fold-search nil) + ;; Save point as a distance to eob - it's invariant w.r.t + ;; indentation. + (pos (- (point-max) (point)))) + (back-to-indentation) + (setq indent (if (lua-comment-or-string-p) + ;; Just restore point posistion. + (lua-calculate-string-or-comment-indentation) + (max 0 (lua-calculate-indentation)))) + + (unless (equal indent (current-column)) + (delete-region (line-beginning-position) (point)) + (indent-to indent)) + + ;; If initial point was within line's indentation, position after + ;; the indentation. Else stay at same point in text. + (when (> (- (point-max) pos) (point)) + (goto-char (- (point-max) pos))) + + indent)) + +(defun lua-calculate-string-or-comment-indentation () + "This should be run when point at `current-indentation' is in a string." + (if (and (lua-string-p) + (not lua-indent-string-contents)) + ;; If inside string and strings aren't to be indented, return + ;; current indentation. + (current-indentation) + + ;; At this point, we know that we're inside comment, so make sure + ;; close-bracket is unindented like a block that starts after + ;; left-shifter. + (let ((left-shifter-p (looking-at "\\s *\\(?:--\\)?\\]\\(?1:=*\\)\\]"))) + (save-excursion + (goto-char (lua-comment-or-string-start-pos)) + (+ (current-indentation) + (if (and left-shifter-p + (looking-at (format "--\\[%s\\[" + (match-string-no-properties 1)))) + 0 + lua-indent-level)))))) + +(defun lua--signum (x) + "Return 1 if X is positive, -1 if negative, 0 if zero." + (cond ((> x 0) 1) ((< x 0) -1) (t 0))) + +(defun lua--ensure-point-within-limit (limit backward) + "Return non-nil if point is within LIMIT going forward. + +With BACKWARD non-nil, return non-nil if point is within LIMIT going +backward. + +If point is beyond limit, move it onto limit." + (if (= (lua--signum (- (point) limit)) + (if backward 1 -1)) + t + (goto-char limit) + nil)) + +(defun lua--escape-from-string (&optional backward) + "Move point outside of string if it is inside one. + +By default, point is placed after the string, with BACKWARD it is placed +before the string." + (interactive) + (let ((parse-state (syntax-ppss))) + (when (nth 3 parse-state) + (if backward + (goto-char (nth 8 parse-state)) + (parse-partial-sexp + (point) (line-end-position) nil nil (syntax-ppss) 'syntax-table)) + t))) + +(defun lua-find-regexp (direction regexp &optional limit) + "Search for a regular expression in the direction specified. + +DIRECTION is one of \\='forward and \\='backward. + +Matches in comments and strings are ignored. If the REGEXP is found, +returns point position, nil otherwise. + +The argument LIMIT is a buffer position that bounds the search." + (let ((search-func (if (eq direction 'forward) + 're-search-forward 're-search-backward)) + (case-fold-search nil)) + (cl-loop + always (or (null limit) + (lua--ensure-point-within-limit + limit (not (eq direction 'forward)))) + always (funcall search-func regexp limit 'noerror) + for match-beg = (match-beginning 0) + for match-end = (match-end 0) + while (or (lua-comment-or-string-p match-beg) + (lua-comment-or-string-p match-end)) + do (let ((parse-state (syntax-ppss))) + (cond + ;; Inside a string + ((nth 3 parse-state) + (lua--escape-from-string (not (eq direction 'forward)))) + ;; Inside a comment + ((nth 4 parse-state) + (goto-char (nth 8 parse-state)) + (when (eq direction 'forward) + (forward-comment 1))))) + finally return (point)))) + +(defconst lua-block-regexp + (eval-when-compile + (rx (or (group symbol-start + (group (or "do" "function" "repeat" "then" + "else" "elseif" "end" "until")) + symbol-end) + (group (any "()[]{}")))))) + +(defconst lua-block-token-alist + '(("do" "\\_<end\\_>" "\\_<for\\|while\\_>" middle-or-open) + ("function" "\\_<end\\_>" nil open) + ("repeat" "\\_<until\\_>" nil open) + ("then" + "\\_<\\(e\\(lse\\(if\\)?\\|nd\\)\\)\\_>" "\\_<\\(else\\)?if\\_>" middle) + ("{" "}" nil open) + ("[" "]" nil open) + ("(" ")" nil open) + ("if" "\\_<then\\_>" nil open) + ("for" "\\_<do\\_>" nil open) + ("while" "\\_<do\\_>" nil open) + ("else" "\\_<end\\_>" "\\_<then\\_>" middle) + ("elseif" "\\_<then\\_>" "\\_<then\\_>" middle) + ("end" nil "\\_<\\(do\\|function\\|then\\|else\\)\\_>" close) + ("until" nil "\\_<repeat\\_>" close) + ("}" nil "{" close) + ("]" nil "\\[" close) + (")" nil "(" close)) + "This is a list of block token information blocks. + +Each token information entry is of the form: + KEYWORD FORWARD-MATCH-REGEXP BACKWARDS-MATCH-REGEXP TOKEN-TYPE + +KEYWORD is the token. + +FORWARD-MATCH-REGEXP is a regexp that matches all possible tokens when +going forward. + +BACKWARDS-MATCH-REGEXP is a regexp that matches all possible tokens when +going backwards. + +TOKEN-TYPE determines where the token occurs on a statement. Open +indicates that the token appears at start, close indicates that it +appears at end, middle indicates that it is a middle type token, and +middle-or-open indicates that it can appear both as a middle or an open +type.") + +(defconst lua-indentation-modifier-regexp + ;; The absence of else is deliberate, since it does not modify the + ;; indentation level per se. It only may cause the line, in which the + ;; else is, to be shifted to the left. + (rx (or (group (or (seq symbol-start + (group (or "do" "function" "repeat" "then" "if" + "else" "elseif" "for" "while")) + symbol-end) + (any "([{"))) + (group (or (seq symbol-start + (group (or "end" "until")) + symbol-end) + (any ")]}")))))) + +(defun lua-get-block-token-info (token) + "Return the block token info entry for TOKEN from lua-block-token-alist." + (assoc token lua-block-token-alist)) + +(defun lua-get-token-match-re (token-info direction) + "Return the relevant match regexp from TOKEN-INFO. + +The argument DIRECTION controls if the search goes forward or backward." + (cond + ((eq direction 'forward) (cadr token-info)) + ((eq direction 'backward) (nth 2 token-info)) + (t nil))) + +(defun lua-get-token-type (token-info) + "Return the relevant match regexp from TOKEN-INFO." + (nth 3 token-info)) + +(defun lua-backwards-to-block-begin-or-end () + "Move backwards to nearest block begin or end. +Return nil if unsuccessful." + (interactive) + (lua-find-regexp 'backward lua-block-regexp)) + +(defun lua-find-matching-token-word (token &optional direction) + "Find matching open- or close-token for TOKEN in DIRECTION. +Point has to be exactly at the beginning of TOKEN, e.g. with | being +point + + {{ }|} -- (lua-find-matching-token-word \"}\" \\='backward) will return + -- the first { + {{ |}} -- (lua-find-matching-token-word \"}\" \\='backward) will find + -- the second {. + +DIRECTION has to be either \\='forward or \\='backward." + (let* ((token-info (lua-get-block-token-info token)) + (match-type (lua-get-token-type token-info)) + ;; If we are on a middle token, go backwards. If it is a + ;; middle or open, go forwards + (search-direction (or direction + (if (or (eq match-type 'open) + (eq match-type 'middle-or-open)) + 'forward + 'backward) + 'backward)) + (match (lua-get-token-match-re token-info search-direction)) + maybe-found-pos) + ;; If we are searching forward from the token at the current point + ;; (i.e. for a closing token), need to step one character forward + ;; first, or the regexp will match the opening token. + (when (eq search-direction 'forward) (forward-char 1)) + (catch 'found + ;; If we are attempting to find a matching token for a terminating + ;; token (i.e. a token that starts a statement when searching + ;; back, or a token that ends a statement when searching forward), + ;; then we don't need to look any further. + (when (or (and (eq search-direction 'forward) + (eq match-type 'close)) + (and (eq search-direction 'backward) + (eq match-type 'open))) + (throw 'found nil)) + (while (lua-find-regexp search-direction lua-indentation-modifier-regexp) + ;; Have we found a valid matching token? + (let* ((found-token (match-string 0)) + (found-pos (match-beginning 0)) + (found-type (lua-get-token-type + (lua-get-block-token-info found-token)))) + (if (not (and match (string-match match found-token))) + ;; No - then there is a nested block. If we were looking + ;; for a block begin token, found-token must be a block + ;; end token; likewise, if we were looking for a block end + ;; token, found-token must be a block begin token, + ;; otherwise there is a grammatical error in the code. + (unless (and (or (eq match-type 'middle) + (eq found-type 'middle) + (eq match-type 'middle-or-open) + (eq found-type 'middle-or-open) + (eq match-type found-type)) + (goto-char found-pos) + (lua-find-matching-token-word + found-token search-direction)) + (when maybe-found-pos + (goto-char maybe-found-pos) + (throw 'found maybe-found-pos))) + ;; Yes. + ;; If it is a not a middle kind, report the location + (unless (or (eq found-type 'middle) + (eq found-type 'middle-or-open)) + (throw 'found found-pos)) + ;; If it is a middle-or-open type, record location, but keep + ;; searching. If we fail to complete the search, we'll + ;; report the location + (when (eq found-type 'middle-or-open) + (setq maybe-found-pos found-pos)) + ;; Cannot use tail recursion. Too much nesting on long + ;; chains of if/elseif. Will reset variables instead. + (setq token found-token) + (setq token-info (lua-get-block-token-info token)) + (setq match (lua-get-token-match-re token-info search-direction)) + (setq match-type (lua-get-token-type token-info))))) + maybe-found-pos))) + +(defun lua-goto-matching-block-token (&optional parse-start direction) + "Find block begion/end token matching the one at the point. +This function moves the point to the token that matches the one at the +current point. Returns the point position of the first character of the +matching token if successful, nil otherwise. + +Optional PARSE-START is a position to which the point should be moved +first. + +DIRECTION has to be \\='forward or \\='backward (\\='forward by default)." + (when parse-start (goto-char parse-start)) + (let ((case-fold-search nil)) + (when-let* (((looking-at lua-indentation-modifier-regexp)) + (position (lua-find-matching-token-word + (match-string 0) direction))) + (goto-char position)))) + +(defun lua-goto-matching-block (&optional noreport) + "Go to the keyword balancing the one under the point. +If the point is on a keyword/brace that starts a block, go to the +matching keyword that ends the block, and vice versa. + +If optional NOREPORT is non-nil, it won't flag an error if there is no +block open/close open." + (interactive) + ;; Search backward to the beginning of the keyword if necessary + (when (and (eq (char-syntax (following-char)) ?w) + (not (looking-at "\\_<"))) + (re-search-backward "\\_<" nil t)) + (if-let* ((position (lua-goto-matching-block-token))) + position + (unless noreport (error "Not on a block control keyword or brace")))) + +(defun lua-skip-ws-and-comments-backward (&optional limit) + "Move point back skipping all whitespace and comments. + +If LIMIT is given, stop at it or before. + +Return non-nil if moved point." + (interactive) + (unless (lua-string-p) + (let ((start-pos (point)) + (comment-start-pos (lua-comment-start-pos)) + (limit (min (point) (or limit (point-min))))) + (when comment-start-pos (goto-char (max limit comment-start-pos))) + (when (< limit (point)) (forward-comment (- limit (point)))) + (when (< (point) limit) (goto-char limit)) + (when (/= start-pos (point)) (point))))) + +(defun lua-skip-ws-and-comments-forward (&optional limit) + "Move point forward skipping all whitespace and comments. + +If LIMIT is given, stop at it or before. + +Return non-nil if moved point." + (interactive) + (unless (lua-string-p) + (let ((start-pos (point)) + (comment-start-pos (lua-comment-start-pos)) + (limit (max (point) (or limit (point-max))))) + ;; Escape from current comment. It is necessary to use "while" + ;; because luadoc parameters have non-comment face, and + ;; parse-partial-sexp with 'syntax-table flag will stop on them. + (when comment-start-pos + (goto-char comment-start-pos) + (forward-comment 1)) + (when (< (point) limit) (forward-comment (- limit (point)))) + (when (< limit (point)) (goto-char limit)) + (when (/= start-pos (point)) (point))))) + +(defun lua-forward-line-skip-blanks (&optional back) + "Move 1 line forward/backward and skip insignificant ws/comment lines. + +Moves point 1 line forward (or backward) skipping lines that contain no +Lua code besides comments. The point is put to the beginning of the +line. + +Returns final value of point as integer or nil if operation failed. + +Non-nil argument BACK changes the direction to backwards." + (let ((start-pos (point))) + (if back + (progn + (beginning-of-line) + (lua-skip-ws-and-comments-backward)) + (forward-line) + (lua-skip-ws-and-comments-forward)) + (beginning-of-line) + (when (> (count-lines start-pos (point)) 0) + (point)))) + +(eval-when-compile + (defconst lua-operator-class + "-+*/^.=<>~:&|")) + +(defconst lua-cont-eol-regexp + (eval-when-compile + (rx-to-string + `(seq (or (group-n 1 + symbol-start + (group (or "and" "or" "not" "in" "for" "while" "local" + "function" "if" "until" "elseif" "return")) + symbol-end) + (seq (or bol (not (any ,lua-operator-class))) + (group-n 2 + (group (or "%" "&" "*" "+" "," "-" "." ".." "/" ":" + "<" "<<" "<=" "=" "==" ">" ">=" ">>" "^" + "|" "~" "~="))))) + (zero-or-more (syntax whitespace)) + point))) + "Regexp that matches the ending of a line that needs continuation. + +This regexp starts from eol and looks for a binary operator or an +unclosed block intro (i.e. `for' without `do' or `if' without `then') +followed by an optional whitespace till the end of the line.") + +(defconst lua-cont-bol-regexp + (eval-when-compile + (rx-to-string + `(seq point (zero-or-more (syntax whitespace)) + (or (group-n 1 + symbol-start + (group (or "and" "in" "not" "or")) + symbol-end) + (seq (group-n 2 + (group (or "%" "&" "*" "+" "," "-" "." ".." "/" ":" + "<" "<<" "<=" "=" "==" ">" ">=" ">>" "^" + "|" "~" "~="))) + (or eol (not (any ,lua-operator-class)))))))) + "Regexp that matches a line that continues previous one. + +This regexp means, starting from point there is an optional whitespace +followed by Lua binary operator. Lua is very liberal when it comes to +continuation line, so we're safe to assume that every line that starts +with a binop continues previous one even though it looked like an +end-of-statement.") + +(defun lua-last-token-continues-p () + "Return non-nil if the last token on this line is a continuation token." + (let ((line-begin (line-beginning-position)) + return-value) + (save-excursion + (end-of-line) + (lua-skip-ws-and-comments-backward line-begin) + (setq return-value (and (re-search-backward lua-cont-eol-regexp line-begin t) + (or (match-beginning 1) + (match-beginning 2)))) + (when (and return-value + (string-equal (match-string-no-properties 0) "return")) + ;; "return" keyword is ambiguous and depends on next token + (unless (save-excursion + (goto-char (match-end 0)) + (forward-comment (point-max)) + (and + ;; Not continuing: at end of file + (not (eobp)) + (or + ;; "function" keyword: it is a continuation, e.g. + ;; + ;; return + ;; function() return 123 end + ;; + (looking-at (lua-rx (symbol "function"))) + ;; Looking at semicolon or any other keyword: not + ;; continuation + (not (looking-at (lua-rx (or ";" lua-keyword))))))) + (setq return-value nil))) + return-value))) + +(defun lua-first-token-continues-p () + "Return non-nil if the first token on this line is a continuation token." + (let ((line-end (line-end-position))) + (save-excursion + (beginning-of-line) + (lua-skip-ws-and-comments-forward line-end) + ;; If first character of the line is inside string, it's a + ;; continuation if strings aren't supposed to be indented, + ;; `lua-calculate-indentation' won't even let the control inside + ;; this function + (and + (re-search-forward lua-cont-bol-regexp line-end t) + (or (match-beginning 1) + (match-beginning 2)))))) + +(defun lua--backward-up-list-noerror () + "Safe version of lua-backward-up-list that does not signal an error." + (condition-case nil + (lua-backward-up-list) + (scan-error nil))) + +(defun lua-backward-up-list () + "Goto starter/opener of the block containing point." + (interactive) + (let ((start-pos (point)) + end-pos) + (or + ;; Return parent block opener token if it exists. + (cl-loop + ;; Search indentation modifier backward, return nil on failure. + always (lua-find-regexp 'backward lua-indentation-modifier-regexp) + ;; Fetch info about the found token + for token = (match-string-no-properties 0) + for token-info = (lua-get-block-token-info token) + for token-type = (lua-get-token-type token-info) + ;; If the token is a close token, continue to skip its opener. If not + ;; close, stop and return found token. + while (eq token-type 'close) + ;; Find matching opener to skip it and continue from beginning. + ;; + ;; Return nil on failure. + always (let ((position (lua-find-matching-token-word token 'backward))) + (and position (goto-char position))) + finally return token-info) + (progn + (setq end-pos (point)) + (goto-char start-pos) + (signal 'scan-error + (list "Block open token not found" + ;; If start-pos == end-pos, the "obstacle" is current + (if (eql start-pos end-pos) start-pos (match-beginning 0)) + (if (eql start-pos end-pos) start-pos (match-end 0)))))))) + +(defun lua--continuation-breaking-line-p () + "Return non-nil if looking at token(-s) that forbid continued line." + (save-excursion + (lua-skip-ws-and-comments-forward (line-end-position)) + (looking-at (lua-rx (or (symbol "do" "while" "repeat" "until" + "if" "then" "elseif" "else" + "for" "local") + lua-funcheader))))) + +(defun lua-is-continuing-statement-p-1 () + "Return non-nil if current lined continues a statement. + +More specifically, return the point in the line that is continued. +The criteria for a continuing statement are: + +* the last token of the previous line is a continuing op, + OR the first token of the current line is a continuing op + +* the expression is not enclosed by a parentheses/braces/brackets" + (let (prev-line continuation-pos parent-block-opener) + (save-excursion (setq prev-line (lua-forward-line-skip-blanks 'back))) + (and prev-line + (not (lua--continuation-breaking-line-p)) + (save-excursion + (or + ;; Binary operator or keyword that implies continuation. + (and (setq continuation-pos + (or (lua-first-token-continues-p) + (save-excursion + (and (goto-char prev-line) + ;; Check last token of previous nonblank line + (lua-last-token-continues-p))))) + (not + ;; Operators/keywords does not create continuation + ;; inside some blocks: + (and (setq parent-block-opener + (car-safe (lua--backward-up-list-noerror))) + (or + ;; Inside parens/brackets + (member parent-block-opener '("(" "[")) + ;; Inside braces if it is a comma + (and (eq (char-after continuation-pos) ?,) + (equal parent-block-opener "{"))))) + continuation-pos)))))) + +(defun lua-is-continuing-statement-p (&optional parse-start) + "Return non-nil if PARSE-START should be indented as continuation line. + +This true is when the line: + +* Is continuing a statement itself + +* Starts with a 1+ block-closer tokens, an top-most block opener is on a + continuation line." + (save-excursion + (when parse-start (goto-char parse-start)) + + ;; If line starts with a series of closer tokens, whether or not the + ;; line is a continuation line is decided by the opener line, e.g. + ;; + ;; x = foo + + ;; long_function_name( + ;; long_parameter_1, + ;; long_parameter_2, + ;; long_parameter_3, + ;; ) + long_function_name2({ + ;; long_parameter_1, + ;; long_parameter_2, + ;; long_parameter_3, + ;; }) + ;; + ;; Final line, "})" is a continuation line, but it is decided by the + ;; opener line, ") + long_function_name2({", which in its turn is + ;; decided by the "long_function_name(" line, which is a + ;; continuation line because the line before it ends with a binary + ;; operator. + (cl-loop + ;; Go to opener line + while (and (lua--goto-line-beginning-rightmost-closer) + (lua--backward-up-list-noerror)) + ;; If opener line is continuing, repeat. If opener line is not + ;; Continuing, return nil. + always (lua-is-continuing-statement-p-1) + ;; We get here if there was no opener to go to: check current line. + finally return (lua-is-continuing-statement-p-1)))) + +(defun lua-make-indentation-info-pair (found-token found-pos) + "Create a pair from FOUND-TOKEN and FOUND-POS for indentation calculation. + +This is a helper function to lua-calculate-indentation-info. +Don't use standalone." + (cond + ;; Functions are a bit tricky to indent right. They can appear in a + ;; lot ot different contexts. Until I find a shortcut, I'll leave it + ;; with a simple relative indentation. + ;; The special cases are for indenting according to the location of + ;; the function. i.e.: + ;; (cons 'absolute (+ (current-column) lua-indent-level)) + ;; TODO: Fix this. It causes really ugly indentations for in-line + ;; functions. + ((string-equal found-token "function") + (cons 'relative lua-indent-level)) + + ;; Block openers + ((and lua-indent-nested-block-content-align + (member found-token (list "{" "(" "["))) + (save-excursion + (let ((found-bol (line-beginning-position))) + (forward-comment (point-max)) + ;; If the next token is on this line and it's not a block + ;; opener, the next line should align to that token. + (if (and (zerop (count-lines found-bol (line-beginning-position))) + (not (looking-at lua-indentation-modifier-regexp))) + (cons 'absolute (current-column)) + (cons 'relative lua-indent-level))))) + + ;; These are not really block starters. They should not add to + ;; indentation. The corresponding "then" and "do" handle the + ;; indentation. + ((member found-token (list "if" "for" "while")) + (cons 'relative 0)) + ;; closing tokens follow: These are usually taken care of by + ;; lua-calculate-indentation-override. + ;; elseif is a bit of a hack. It is not handled separately, but it + ;; needs to nullify a previous then if on the same line. + ((member found-token (list "until" "elseif")) + (save-excursion + (let* ((line-beginning (line-beginning-position)) + (same-line (and (lua-goto-matching-block-token found-pos 'backward) + (<= line-beginning (point))))) + (if same-line + (cons 'remove-matching 0) + (cons 'relative 0))))) + + ;; else is a special case; if its matching block token is on the same + ;; line, instead of removing the matching token, it has to replace + ;; it, so that either the next line will be indented correctly, or + ;; the end on the same line will remove the effect of the else. + ((string-equal found-token "else") + (save-excursion + (let* ((line-beginning (line-beginning-position)) + (same-line (and (lua-goto-matching-block-token found-pos 'backward) + (<= line-beginning (point))))) + (if same-line + (cons 'replace-matching (cons 'relative lua-indent-level)) + (cons 'relative lua-indent-level))))) + + ;; Block closers. If they are on the same line as their openers, + ;; they simply eat up the matching indentation modifier. Otherwise, + ;; they pull indentation back to the matching block opener. + ((member found-token (list ")" "}" "]" "end")) + (save-excursion + (let* ((line-beginning (line-beginning-position)) + (same-line (and (lua-goto-matching-block-token found-pos 'backward) + (<= line-beginning (point)))) + (opener-pos (point)) + opener-continuation-offset) + (if same-line + (cons 'remove-matching 0) + (back-to-indentation) + (setq opener-continuation-offset + (if (lua-is-continuing-statement-p-1) lua-indent-level 0)) + + ;; Accumulate indentation up to opener, including indentation. + ;; If there were no other indentation modifiers until said + ;; opener, ensure there is no continuation after the closer. + `(multiple . ((absolute . ,(- (current-indentation) + opener-continuation-offset)) + ,@(when (/= opener-continuation-offset 0) + (list (cons 'continued-line + opener-continuation-offset))) + ,@(delete nil (list (lua-calculate-indentation-info-1 + nil opener-pos))) + (cancel-continued-line . nil))))))) + + ((member found-token '("do" "then")) + `(multiple . ((cancel-continued-line . nil) (relative . ,lua-indent-level)))) + + ;; Everything else. This is from the original code: If opening a + ;; block (match-data 1 exists), then push indentation one level up, + ;; if it is closing a block, pull it one level down. + ('other-indentation-modifier + (cons 'relative (if (nth 2 (match-data)) + ;; Beginning of a block matched + lua-indent-level + ;; End of a block matched + (- lua-indent-level)))))) + +(defun lua-add-indentation-info-pair (pair info-list) + "Add the indentation info PAIR to the list of indentation INFO-LIST. +This function has special case handling for two tokens: remove-matching, +and replace-matching. These two tokens are cleanup tokens that remove +or alter the effect of a previously recorded indentation info. + +When a remove-matching token is encountered, the last recorded info, +i.e. the car of the list is removed. This is used to roll-back an +indentation of a block opening statement when it is closed. + +When a replace-matching token is seen, the last recorded info is +removed, and the cdr of the replace-matching info is added in its place. +This is used when a middle-of the block (the only case is `else') is +seen on the same line the block is opened." + (cond + ((eq 'multiple (car pair)) + (let ((info-pair-elts (cdr pair))) + (while info-pair-elts + (setq info-list (lua-add-indentation-info-pair + (car info-pair-elts) info-list) + info-pair-elts (cdr info-pair-elts))) + info-list)) + ((eq 'cancel-continued-line (car pair)) + (if (eq (caar info-list) 'continued-line) + (cdr info-list) + info-list)) + ((eq 'remove-matching (car pair)) + ;; Remove head of list + (cdr info-list)) + ((eq 'replace-matching (car pair)) + ;; Remove head of list, and add the cdr of pair instead + (cons (cdr pair) (cdr info-list))) + ((listp (cdr-safe pair)) + (nconc pair info-list)) + (t + ;; Just add the pair + (cons pair info-list)))) + +(defun lua-calculate-indentation-info-1 (indentation-info bound) + "Helper function for `lua-calculate-indentation-info'. + +Return list of indentation modifiers from point to BOUND. + +The argument INDENTATION-INFO is an indentation INFO-LIST." + (while (lua-find-regexp 'forward lua-indentation-modifier-regexp + bound) + (let ((found-token (match-string 0)) + (found-pos (match-beginning 0))) + (setq indentation-info + (lua-add-indentation-info-pair + (lua-make-indentation-info-pair found-token found-pos) + indentation-info)))) + indentation-info) + +(defun lua-calculate-indentation-info (&optional parse-end) + "Compute how each block token on the line affects indentation. +The effect of each token can be either a shift relative to the current +indentation level, or indentation to some absolute column. This +information is collected in a list of indentation info pairs, which +denote absolute and relative each, and the shift/column to indent to. + +The argument PARSE-END is a buffer position that bounds the calculation." + (let (indentation-info cont-stmt-pos) + (while (setq cont-stmt-pos (lua-is-continuing-statement-p)) + (lua-forward-line-skip-blanks 'back) + (when (< cont-stmt-pos (point)) + (goto-char cont-stmt-pos))) + + ;; Calculate indentation modifiers for the line itself + (setq indentation-info (list (cons 'absolute (current-indentation)))) + + (back-to-indentation) + (setq indentation-info + (lua-calculate-indentation-info-1 + indentation-info (min parse-end (line-end-position)))) + + ;; And do the following for each continuation line before PARSE-END + (while (and (eql (forward-line 1) 0) + (<= (point) parse-end)) + + ;; Handle continuation lines: + (if (lua-is-continuing-statement-p) + ;; If it's the first continuation line, add one level + (unless (eq (car (car indentation-info)) 'continued-line) + (push (cons 'continued-line lua-indent-level) indentation-info)) + + ;; If it's the first non-continued line, subtract one level + (when (eq (car (car indentation-info)) 'continued-line) + (push (cons 'stop-continued-line (- lua-indent-level)) indentation-info))) + + ;; Add modifiers found in this continuation line + (setq indentation-info + (lua-calculate-indentation-info-1 + indentation-info (min parse-end (line-end-position))))) + + indentation-info)) + +(defun lua-accumulate-indentation-info (reversed-indentation-info) + "Accumulate indent information from lua-calculate-indentation-info. +Returns either the relative indentation shift, or the absolute column to +indent to. + +The argument REVERSED-INDENTATION-INFO is an indentation INFO-LIST." + (let (indentation-info + (type 'relative) + (accu 0)) + ;; Aggregate all neighbouring relative offsets, reversing the INFO list. + (dolist (elt reversed-indentation-info) + (if (and (eq (car elt) 'relative) + (eq (caar indentation-info) 'relative)) + (setcdr (car indentation-info) (+ (cdar indentation-info) (cdr elt))) + (push elt indentation-info))) + + ;; Aggregate indentation info, taking 'absolute modifiers into account. + (mapc (lambda (x) + (if-let* ((new-val (cdr x)) + ((eq 'absolute (car x)))) + (setq type 'absolute + accu new-val) + (setq accu (+ accu new-val)))) + indentation-info) + + (cons type accu))) + +(defun lua-calculate-indentation-block-modifier (&optional parse-end) + "Return amount by which this line modifies the indentation. +Beginnings of blocks add lua-indent-level once each, and endings of +blocks subtract lua-indent-level once each. This function is used to +determine how the indentation of the following line relates to this one. + +The argument PARSE-END is a buffer position that bounds the calculation." + (let (indentation-info) + (save-excursion + ;; First go back to the line that starts it all + ;; lua-calculate-indentation-info will scan through the whole thing + (let ((case-fold-search nil)) + (setq indentation-info + (lua-accumulate-indentation-info + (lua-calculate-indentation-info parse-end))))) + + (if (eq (car indentation-info) 'absolute) + (- (cdr indentation-info) (current-indentation)) + (cdr indentation-info)))) + +(eval-when-compile + (defconst lua--function-name-rx + '(seq symbol-start + (+ (any alnum "_")) + (* "." (+ (any alnum "_"))) + (? ":" (+ (any alnum "_"))) + symbol-end) + "Lua function name regexp in `rx'-SEXP format.")) + +(defconst lua--left-shifter-regexp + (eval-when-compile + (rx + ;; This regexp should answer the following questions: + ;; 1. Is there a left shifter regexp on that line? + ;; 2. Where does block-open token of that left shifter reside? + (or (seq (group-n 1 symbol-start "local" (+ blank)) "function" symbol-end) + (seq (group-n 1 (eval lua--function-name-rx) (* blank)) (any "{(")) + (seq (group-n 1 (or + ;; Assignment statement prefix + (seq (* nonl) (not (any "<=>~")) "=" (* blank)) + ;; Return statement prefix + (seq word-start "return" word-end (* blank)))) + ;; Right hand side + (or "{" + "function" + "(" + (seq (group-n 1 (eval lua--function-name-rx) (* blank)) + (any "({"))))))) + + "Regular expression that matches left-shifter expression. + +Left-shifter expression is defined as follows. If a block follows a +left-shifter expression, its contents & block-close token should be +indented relative to left-shifter expression indentation rather then to +block-open token. + +For example: + -- `local a = ' is a left-shifter expression + -- `function' is a block-open token + local a = function() + -- block contents is indented relative to left-shifter + foobarbaz() + -- block-end token is unindented to left-shifter indentation + end + +The following left-shifter expressions are currently handled: +1. local function definition with function block, begin-end +2. function call with arguments block, () or {} +3. assignment/return statement with + - table constructor block, {} + - function call arguments block, () or {} block + - function expression a.k.a. lambda, begin-end block.") + +(defun lua-point-is-after-left-shifter-p () + "Check if point is right after a left-shifter expression. + +See `lua--left-shifter-regexp' for description & example of left-shifter +expression." + (save-excursion + (let ((old-point (point))) + (back-to-indentation) + (and + (/= (point) old-point) + (looking-at lua--left-shifter-regexp) + (= old-point (match-end 1)))))) + +(defun lua--goto-line-beginning-rightmost-closer (&optional parse-start) + "Move point to the opening of the rightmost closing bracket at point. +The argument PARSE-START is a buffer position to start from." + (let (case-fold-search pos line-end-pos return-val) + (save-excursion + (when parse-start (goto-char parse-start)) + (setq line-end-pos (line-end-position)) + (back-to-indentation) + (unless (lua-comment-or-string-p) + (cl-loop while (and (<= (point) line-end-pos) + (looking-at lua-indentation-modifier-regexp)) + for token-info = (lua-get-block-token-info (match-string 0)) + for token-type = (lua-get-token-type token-info) + while (not (eq token-type 'open)) + do (progn + (setq pos (match-beginning 0) + return-val token-info) + (goto-char (match-end 0)) + (forward-comment (line-end-position)))))) + (when pos + (goto-char pos) + return-val))) + +(defun lua-calculate-indentation-override (&optional parse-start) + "Return overriding indentation amount for special cases. + +If there's a sequence of block-close tokens starting at the beginning of +the line, calculate indentation according to the line containing +block-open token for the last block-close token in the sequence. + +If not, return nil. + +Optional PARSE-START is a position to which the point should be moved +first." + (let (case-fold-search rightmost-closer-info opener-info opener-pos) + (save-excursion + (when (and (setq rightmost-closer-info (lua--goto-line-beginning-rightmost-closer parse-start)) + (setq opener-info (lua--backward-up-list-noerror)) + ;; Ensure opener matches closer. + (string-match (lua-get-token-match-re rightmost-closer-info 'backward) + (car opener-info))) + + ;; Special case: "middle" tokens like for/do, while/do, if/then, + ;; elseif/then: corresponding "end" or corresponding "else" must + ;; be unindented to the beginning of the statement, which is not + ;; necessarily the same as beginning of string that contains + ;; "do", e.g. + ;; + ;; while ( + ;; foo and + ;; bar) do + ;; hello_world() + ;; end + (setq opener-pos (point)) + (when (/= (- opener-pos (line-beginning-position)) (current-indentation)) + (unless (or + (and (string-equal (car opener-info) "do") + (member (car (lua--backward-up-list-noerror)) + '("while" "for"))) + (and (string-equal (car opener-info) "then") + (member (car (lua--backward-up-list-noerror)) + '("if" "elseif")))) + (goto-char opener-pos))) + + ;; (let (cont-stmt-pos) + ;; (while (setq cont-stmt-pos (lua-is-continuing-statement-p)) + ;; (goto-char cont-stmt-pos))) + ;; Exception cases: when the start of the line is an assignment, + ;; go to the start of the assignment instead of the matching + ;; item + (if (and lua-indent-close-paren-align + (member (car opener-info) '("{" "(" "[")) + (not (lua-point-is-after-left-shifter-p))) + (current-column) + (current-indentation)))))) + +(defun lua-calculate-indentation () + "Return appropriate indentation for current line as Lua code." + (save-excursion + (let ((cur-line-begin-pos (line-beginning-position))) + (or + ;; When calculating indentation, do the following: + ;; 1. check, if the line starts with indentation-modifier + ;; (open/close brace) and if it should be indented/unindented + ;; in special way + (lua-calculate-indentation-override) + + (when (lua-forward-line-skip-blanks 'back) + ;; The order of function calls here is important. block + ;; modifier call may change the point to another line + (let* ((modifier + (lua-calculate-indentation-block-modifier cur-line-begin-pos))) + (+ (current-indentation) modifier))) + + ;; 4. if there's no previous line, indentation is 0 + 0)))) + +(defvar lua--beginning-of-defun-re + (lua-rx-to-string '(: bol (? (symbol "local") ws+) lua-funcheader)) + "Lua top level (matches only at the beginning of line) function header regex.") + +(defun lua-beginning-of-proc (&optional arg) + "Move backward to the beginning of a Lua proc (or similar). + +With argument ARG, do it that many times. Negative ARG -N means move +forward to Nth following beginning of proc. + +Return non-nil unless search stops due to beginning or end of buffer." + (interactive "P") + (if-let* ((arg (or arg 1)) + ((> arg 0))) + (re-search-backward lua--beginning-of-defun-re nil t arg) + (re-search-forward lua--beginning-of-defun-re nil t (abs arg)) + (forward-line 0))) + +(defun lua-end-of-proc (&optional arg) + "Move forward to next end of Lua proc (or similar). + +With argument ARG, do it that many times. Negative ARG -N means move +back to Nth preceding end of proc. + +This function just searches for a `end' at the beginning of a line." + (interactive "P") + (if-let* ((arg (or arg 1)) + ((> arg 0))) + (re-search-forward "^end" nil t arg) + (re-search-backward "^end" nil t (abs arg))) + (forward-line)) + +(defvar lua-process-init-code + (mapconcat + 'identity + '("local loadstring = loadstring or load" + "function luamode_loadstring(str, displayname, lineoffset)" + " if lineoffset > 1 then" + " str = string.rep('\\n', lineoffset - 1) .. str" + " end" + "" + " local x, e = loadstring(str, '@'..displayname)" + " if e then" + " error(e)" + " end" + " return x()" + "end") + " ")) + +(defun lua-make-lua-string (str) + "Convert STR to Lua literal." + (save-match-data + (with-temp-buffer + (insert str) + (goto-char (point-min)) + (while (re-search-forward "[\"'\\\t\\\n]" nil t) + (cond + ((string= (match-string 0) "\n") + (replace-match "\\\\n")) + ((string= (match-string 0) "\t") + (replace-match "\\\\t")) + (t + (replace-match "\\\\\\&" t)))) + (concat "'" (buffer-string) "'")))) + +;;;###autoload +(defalias 'run-lua #'lua-start-process) + +;;;###autoload +(defun lua-start-process (&optional name program startfile &rest switches) + "Start a Lua process named NAME, running PROGRAM. +PROGRAM defaults to NAME, which defaults to `lua-default-application'. +When called interactively, switch to the process buffer. + +STARTFILE is the name of a file, whose contents are sent to the process +as its initial input. + +SWITCHES is a list of strings passed as arguments to PROGRAM." + (interactive) + (setq name (or name (if (consp lua-default-application) + (car lua-default-application) + lua-default-application))) + (setq program (or program lua-default-application)) + ;; Don't re-initialize if there already is a lua process + (unless (comint-check-proc (format "*%s*" name)) + (setq lua-process-buffer (apply #'make-comint name program startfile + (or switches lua-default-command-switches))) + (setq lua-process (get-buffer-process lua-process-buffer)) + (set-process-query-on-exit-flag lua-process nil) + (with-current-buffer lua-process-buffer + (setq lua--repl-buffer-p t) + (compilation-shell-minor-mode 1) + (setq-local comint-prompt-regexp lua-prompt-regexp) + + ;; Don't send initialization code until seeing the prompt to + ;; ensure that the interpreter is ready. + (while (not (lua-prompt-line)) + (accept-process-output (get-buffer-process (current-buffer))) + (goto-char (point-max))) + (lua-send-string lua-process-init-code))) + + ;; When called interactively, switch to process buffer + (when (called-interactively-p 'any) + (switch-to-buffer lua-process-buffer))) + +(defun lua-get-create-process () + "Return active Lua process creating one if necessary." + (lua-start-process) + lua-process) + +(defun lua-kill-process () + "Kill Lua process and its buffer." + (interactive) + (when (buffer-live-p lua-process-buffer) + (kill-buffer lua-process-buffer) + (setq lua-process-buffer nil))) + +(defun lua-set-lua-region-start (&optional arg) + "Set start of region for `lua-send-lua-region' to point or ARG." + (interactive) + (set-marker lua-region-start (or arg (point)))) + +(defun lua-set-lua-region-end (&optional arg) + "Set end of region for `lua-send-lua-region' to point or ARG." + (interactive) + (set-marker lua-region-end (or arg (point)))) + +(defun lua-send-string (str) + "Send STR plus a newline to the Lua process. + +If `lua-process' is nil or dead, start a new process first." + (unless (string-equal (substring str -1) "\n") + (setq str (concat str "\n"))) + (process-send-string (lua-get-create-process) str)) + +(defun lua-send-current-line () + "Send current line to the Lua process, found in `lua-process'. +If `lua-process' is nil or dead, start a new process first." + (interactive) + (lua-send-region (line-beginning-position) (line-end-position))) + +(defun lua-send-defun (pos) + "Send the function definition around POS to the Lua process." + (interactive "d") + (save-excursion + (let ((start (if (save-match-data (looking-at "^function[ \t]")) + ;; point already at the start of "function". We + ;; need to handle this case explicitly since + ;; lua-beginning-of-proc will move to the beginning + ;; of the _previous_ function. + (point) + ;; point is not at the beginning of function, move + ;; there and bind start to that position + (lua-beginning-of-proc) + (point))) + (end (progn (lua-end-of-proc) (point)))) + + ;; Make sure point is in a function definition before sending to + ;; the process + (if (and (>= pos start) (< pos end)) + (lua-send-region start end) + (error "Not on a function definition"))))) + +(defun lua-maybe-skip-shebang-line (start) + "Skip interpreter line at beginning of buffer. + +Return a position that is after Lua-recognized shebang line (1st +character in file must be #) if START is at its beginning. Otherwise, +return START." + (save-restriction + (widen) + (if (and (eq start (point-min)) + (eq (char-after start) ?#)) + (save-excursion + (goto-char start) + (forward-line) + (point)) + start))) + +(defun lua-send-region (start end) + "Send region between START and END to the inferior Lua process." + (interactive "r") + (setq start (lua-maybe-skip-shebang-line start)) + (let* ((lineno (line-number-at-pos start)) + (lua-file (or (buffer-file-name) (buffer-name))) + (region-str (buffer-substring-no-properties start end)) + (command + ;; Print empty line before executing the code so that the + ;; first line of output doesn't end up on the same line as + ;; current prompt. + (format "print(''); luamode_loadstring(%s, %s, %s);\n" + (lua-make-lua-string region-str) + (lua-make-lua-string lua-file) + lineno))) + (lua-send-string command) + (when lua-always-show (lua-show-process-buffer)))) + +(defun lua-prompt-line () + "Return non-nil if the inferior Lua process prompt is available." + (save-excursion + (save-match-data + (forward-line 0) + (when (looking-at comint-prompt-regexp) + (match-end 0))))) + +(defun lua-send-lua-region () + "Send preset Lua region to Lua process." + (interactive) + (unless (and lua-region-start lua-region-end) + (error "Region not set")) + (lua-send-region lua-region-start lua-region-end)) + +(defalias 'lua-send-proc 'lua-send-defun) + +(defun lua-send-buffer () + "Send whole buffer to Lua process." + (interactive) + (lua-send-region (point-min) (point-max))) + +(defun lua-restart-with-whole-file () + "Restart Lua process and send whole file as input." + (interactive) + (lua-kill-process) + (lua-send-buffer)) + +(defun lua-show-process-buffer () + "Make sure `lua-process-buffer' is being displayed. +Create a Lua process if one doesn't already exist." + (interactive) + (display-buffer (process-buffer (lua-get-create-process)))) + +(defun lua-hide-process-buffer () + "Delete all windows that display `lua-process-buffer'." + (interactive) + (when (buffer-live-p lua-process-buffer) + (delete-windows-on lua-process-buffer))) + +(defun lua--funcname-char-p (c) + "Check if character C is part of a function name. +Return nil if C is nil. See `lua-funcname-at-point'." + (and c (string-match-p "\\`[A-Za-z_.]\\'" (string c)))) + +(defun lua-funcname-at-point () + "Get current Name { '.' Name } sequence." + (when (or (lua--funcname-char-p (char-before)) + (lua--funcname-char-p (char-after))) + (save-excursion + (save-match-data + (re-search-backward "\\`\\|[^A-Za-z_.]") + ;; NOTE: `point' will be either at the start of the buffer or on + ;; a non-symbol character. + (re-search-forward "\\([A-Za-z_]+\\(?:\\.[A-Za-z_]+\\)*\\)") + (match-string-no-properties 1))))) + +(defun lua-search-documentation () + "Search Lua documentation for the word at the point." + (interactive) + (let ((url (concat lua-documentation-url "#pdf-" (lua-funcname-at-point)))) + (funcall lua-documentation-function url))) + +(defun lua-toggle-electric-state (&optional arg) + "Toggle the electric indentation feature. +Optional numeric ARG, if supplied, turns on electric indentation when +positive, turns it off when negative, and just toggles it when zero or +left out." + (interactive "P") + (let ((num_arg (prefix-numeric-value arg))) + (setq lua-electric-flag (cond ((or (null arg) + (zerop num_arg)) (not lua-electric-flag)) + ((< num_arg 0) nil) + ((> num_arg 0) t)))) + (message "%S" lua-electric-flag)) + +(defun lua-forward-sexp (&optional count) + "Forward to block end. +A positive integer argument COUNT means to forward that many times." + (interactive "p") + (unless (or (not count) (>= count 0)) + (error "Negative offsets not supported")) + (save-match-data + (let ((count (or count 1)) + (block-start (mapcar 'car lua-sexp-alist))) + (while (> count 0) + ;; Skip whitespace + (skip-chars-forward " \t\n") + (if (looking-at (regexp-opt block-start 'words)) + (let ((keyword (match-string 1))) + (lua-find-matching-token-word keyword 'forward)) + ;; If the current keyword is not a "begin" keyword, then just + ;; perform the normal forward-sexp. + (forward-sexp 1)) + (setq count (1- count)))))) + +;; Flymake integration + +(defcustom lua-luacheck-program "luacheck" + "Name of the luacheck executable." + :type 'string + :version "31.1") + +(defvar-local lua--flymake-process nil) + +(defun lua-flymake (report-fn &rest _args) + "Flymake backend using the luacheck program. +Takes a Flymake callback REPORT-FN as argument, as expected of a +member of `flymake-diagnostic-functions'." + (when (process-live-p lua--flymake-process) + (kill-process lua--flymake-process)) + (let ((source (current-buffer))) + (save-restriction + (widen) + (setq lua--flymake-process + (make-process + :name "luacheck" :noquery t :connection-type 'pipe + :buffer (generate-new-buffer " *flymake-luacheck*") + :command `(,lua-luacheck-program + "--codes" "--ranges" "--formatter" "plain" "-") + :sentinel + (lambda (proc _event) + (when (eq 'exit (process-status proc)) + (unwind-protect + (if (with-current-buffer source + (eq proc lua--flymake-process)) + (with-current-buffer (process-buffer proc) + (goto-char (point-min)) + (cl-loop + while (search-forward-regexp + "^\\([^:]*\\):\\([0-9]+\\):\\([0-9]+\\)-\\([0-9]+\\): \\(.*\\)$" + nil t) + for line = (string-to-number (match-string 2)) + for col1 = (string-to-number (match-string 3)) + for col2 = (1+ (string-to-number (match-string 4))) + for msg = (match-string 5) + for type = (if (string-match-p "\\`(E" msg) :error :warning) + collect (flymake-make-diagnostic source + (cons line col1) + (cons line col2) + type + msg) + into diags + finally (funcall report-fn diags))) + (flymake-log :warning "Canceling obsolete check %s" proc)) + (kill-buffer (process-buffer proc))))))) + (process-send-region lua--flymake-process (point-min) (point-max)) + (process-send-eof lua--flymake-process)))) + +;; Menu bar + +(easy-menu-define lua-mode-menu lua-mode-map + "Menu bar entry for `lua-mode'." + `("Lua" + ["Search Documentation" lua-search-documentation] + ["Send Buffer" lua-send-buffer] + ["Send Proc" lua-send-proc] + ["Send Region" lua-send-region] + ["Send Current Line" lua-send-current-line] + ["Set Lua-Region Start" lua-set-lua-region-start] + ["Set Lua-Region End" lua-set-lua-region-end] + ["Send Lua-Region" lua-send-lua-region] + ["Beginning Of Proc" lua-beginning-of-proc] + ["End Of Proc" lua-end-of-proc] + ["Show Process Buffer" lua-show-process-buffer] + ["Hide Process Buffer" lua-hide-process-buffer] + ["Kill Process" lua-kill-process] + ["Restart With Whole File" lua-restart-with-whole-file])) + +(provide 'lua-mode) + +;;; lua-mode.el ends here diff --git a/test/lisp/progmodes/lua-mode-resources/font-lock.lua b/test/lisp/progmodes/lua-mode-resources/font-lock.lua new file mode 100644 index 00000000000..bcf77b632c2 --- /dev/null +++ b/test/lisp/progmodes/lua-mode-resources/font-lock.lua @@ -0,0 +1,184 @@ +#!/usr/bin/env lua +-- ^ font-lock-comment-face +-- Comment +-- <- font-lock-comment-delimiter-face +-- ^ font-lock-comment-face +--[[ +-- ^ font-lock-comment-face +Multi-line comment +-- ^ font-lock-comment-face +]] +-- <- font-lock-comment-face +local line_comment = "comment" -- comment +-- ^ font-lock-comment-face + +-- Definition +local function f1() end +-- ^ font-lock-function-name-face +local f2 = function() end +-- ^ font-lock-function-name-face +local tb = { f1 = function() end } +-- ^ font-lock-function-name-face +function tb.f2() end +-- ^ font-lock-function-name-face +function tb:f3() end +-- ^ font-lock-function-name-face +tbl.f4 = function() end +-- ^ font-lock-function-name-face +function x.y:z() end +-- ^ font-lock-function-name-face + +-- Keyword +if true then +-- <- font-lock-keyword-face +-- ^ font-lock-keyword-face +elseif true then +-- <- font-lock-keyword-face +else end +-- <- font-lock-keyword-face +-- ^ font-lock-keyword-face +local p = {} +-- ^ font-lock-keyword-face +for k,v in pairs({}) do end +-- <- font-lock-keyword-face +-- ^ font-lock-keyword-face +repeat if true then break end until false +-- <- font-lock-keyword-face +-- ^ font-lock-keyword-face +-- ^ font-lock-keyword-face +while true do end +-- <- font-lock-keyword-face +-- ^ font-lock-keyword-face +function fn() return true end +-- <- font-lock-keyword-face +-- ^ font-lock-keyword-face +goto label1 +-- ^ font-lock-keyword-face +::label1:: +if true and not false or nil then +-- ^ font-lock-keyword-face +-- ^ font-lock-keyword-face +-- ^ font-lock-keyword-face +end + +-- String +local _ +_ = "x" +-- ^ font-lock-string-face +_ = 'x' +-- ^ font-lock-string-face +_ = "x\ty" +-- ^ font-lock-string-face +-- ^ font-lock-string-face +_ = "x\"y" +-- ^ font-lock-string-face +-- ^ font-lock-string-face +_ = 'x\'y' +-- ^ font-lock-string-face +-- ^ font-lock-string-face +_ = "x\z + y" +-- ^ font-lock-string-face +_ = "x\0900y" +-- ^ font-lock-string-face +_ = "x\09y" +-- ^ font-lock-string-face +_ = "x\0y" +-- ^ font-lock-string-face +_ = "x\u{1f602}y" +-- ^ font-lock-string-face +_ = [[x]] +-- ^ font-lock-string-face +_ = [=[x]=] +-- ^ font-lock-string-face + +-- Assignment +local n = 0 +-- ^ font-lock-variable-name-face +for i=0,9 do end +-- ^ font-lock-variable-name-face + +-- Constant +::label2:: +-- ^ font-lock-constant-face +goto label2 +-- ^ font-lock-constant-face + +-- Builtin +assert() +-- <- font-lock-builtin-face +bit32() +-- <- font-lock-builtin-face +collectgarbage() +-- <- font-lock-builtin-face +coroutine() +-- <- font-lock-builtin-face +debug() +-- <- font-lock-builtin-face +dofile() +-- <- font-lock-builtin-face +error() +-- <- font-lock-builtin-face +getmetatable() +-- <- font-lock-builtin-face +io() +-- <- font-lock-builtin-face +ipairs() +-- <- font-lock-builtin-face +load() +-- <- font-lock-builtin-face +loadfile() +-- <- font-lock-builtin-face +math() +-- <- font-lock-builtin-face +next() +-- <- font-lock-builtin-face +os() +-- <- font-lock-builtin-face +package() +-- <- font-lock-builtin-face +pairs() +-- <- font-lock-builtin-face +pcall() +-- <- font-lock-builtin-face +print() +-- <- font-lock-builtin-face +rawequal() +-- <- font-lock-builtin-face +rawget() +-- <- font-lock-builtin-face +rawlen() +-- <- font-lock-builtin-face +rawset() +-- <- font-lock-builtin-face +require() +-- <- font-lock-builtin-face +select() +-- <- font-lock-builtin-face +setmetatable() +-- <- font-lock-builtin-face +string() +-- <- font-lock-builtin-face +table() +-- <- font-lock-builtin-face +tonumber() +-- <- font-lock-builtin-face +tostring() +-- <- font-lock-builtin-face +type() +-- <- font-lock-builtin-face +utf8() +-- <- font-lock-builtin-face +warn() +-- <- font-lock-builtin-face +xpcall() +-- <- font-lock-builtin-face +print(_G) +-- ^ font-lock-builtin-face +print(_VERSION) +-- ^ font-lock-builtin-face + +-- Variable +function fn(x, y) end +-- ^ font-lock-variable-name-face +-- ^ font-lock-variable-name-face diff --git a/test/lisp/progmodes/lua-mode-resources/hide-show.lua b/test/lisp/progmodes/lua-mode-resources/hide-show.lua new file mode 100644 index 00000000000..a23b46437bf --- /dev/null +++ b/test/lisp/progmodes/lua-mode-resources/hide-show.lua @@ -0,0 +1,35 @@ +--[[ +This is a +comment block. +]] +local function fun () + print("fun") +end +local f = (function () + print(1) +end) +for i = 1, 10 do + print(i) +end +repeat + print("repeat") +until false +while true do + print("while") +end +do + print(1) +end +if true then + print(1) +elseif false then + print(0) +else + print(0) +end +function f1 (has, + lots, + of, + parameters) + print("ok") +end diff --git a/test/lisp/progmodes/lua-mode-resources/indent.erts b/test/lisp/progmodes/lua-mode-resources/indent.erts new file mode 100644 index 00000000000..8b4d8dd0921 --- /dev/null +++ b/test/lisp/progmodes/lua-mode-resources/indent.erts @@ -0,0 +1,1061 @@ +Code: + (lambda () + (lua-mode) + (setq-local indent-tabs-mode nil) + (setq-local lua-indent-level 2) + (indent-region (point-min) (point-max))) + +Name: Function Indent 1 + +=-= +function f1(n) +print(n) +return n + 1 +end +=-= +function f1(n) + print(n) + return n + 1 +end +=-=-= + +Name: Function Indent 2 + +=-= +local function f2(n) +print(n) +return n * 2 +end +=-= +local function f2(n) + print(n) + return n * 2 +end +=-=-= + +Name: Function Indent 3 + +=-= +local f3 = function(n) +print(n) +return n / 3 +end +=-= +local f3 = function(n) + print(n) + return n / 3 +end +=-=-= + +Name: Function Indent 4 + +=-= +function f4(...) +local f = function (...) +if ok +then print(1) +else print(0) +end +end +return f +end +=-= +function f4(...) + local f = function (...) + if ok + then print(1) + else print(0) + end + end + return f +end +=-=-= + +Name: Function Indent 5 + +=-= +function f5(...) +local f = function (...) +if ok +then +print(1) +else +print(0) +end +end +return f +end +=-= +function f5(...) + local f = function (...) + if ok + then + print(1) + else + print(0) + end + end + return f +end +=-=-= + +Name: Function Indent 6 + +=-= +function f6(...) +local f = function (...) +if ok then +print(1) +else +print(0) +end +end +return f +end +=-= +function f6(...) + local f = function (...) + if ok then + print(1) + else + print(0) + end + end + return f +end +=-=-= + +Name: Function Indent 7 + +=-= +f7(function() +print'ok' +end) +=-= +f7(function() + print'ok' +end) +=-=-= + +Name: Function Indent 8 + +=-= +;(function () + return true + end)() +=-= +;(function () + return true + end)() +=-=-= + +Name: Conditional Indent 1 + +=-= +if true then +print(true) +return 1 +elseif false then +print(false) +return -1 +else +print(nil) +return 0 +end +=-= +if true then + print(true) + return 1 +elseif false then + print(false) + return -1 +else + print(nil) + return 0 +end +=-=-= + +Name: Conditional Indent 2 + +=-= +if true + then + print(true) + return 1 + elseif false + then + print(false) + return -1 + else + print(nil) + return 0 +end +=-= +if true +then + print(true) + return 1 +elseif false +then + print(false) + return -1 +else + print(nil) + return 0 +end +=-=-= + +Name: Conditional Indent 3 + +=-= +if true + then return 1 + elseif false + then return -1 + else return 0 +end +=-= +if true +then return 1 +elseif false +then return -1 +else return 0 +end +=-=-= + +Name: Loop Indent 1 + +=-= +for k,v in pairs({}) do + print(k) + print(v) +end +=-= +for k,v in pairs({}) do + print(k) + print(v) +end +=-=-= + +Name: Loop Indent 2 + +=-= +for i=1,10 + do print(i) +end +=-= +for i=1,10 +do print(i) +end +=-=-= + +Name: Loop Indent 3 + +=-= +while n < 10 do + n = n + 1 + print(n) +end +=-= +while n < 10 do + n = n + 1 + print(n) +end +=-=-= + +Name: Loop Indent 4 + +=-= +while n < 10 + do + n = n + 1 + print(n) +end +=-= +while n < 10 +do + n = n + 1 + print(n) +end +=-=-= + +Name: Loop Indent 5 + +=-= +for i=0,9 do +repeat n = n+1 + until n > 99 +end +=-= +for i=0,9 do + repeat n = n+1 + until n > 99 +end +=-=-= + +Name: Loop Indent 6 + +=-= +repeat +z = z * 2 +print(z) +until z > 12 +=-= +repeat + z = z * 2 + print(z) +until z > 12 +=-=-= + +Name: Loop Indent 7 + +=-= +for i,x in ipairs(t) do +while i < 9 +do +local n = t[x] +repeat n = n + 1 +until n > #t +while n < 99 +do +print(n) +end +end +print(t[i]) +end +=-= +for i,x in ipairs(t) do + while i < 9 + do + local n = t[x] + repeat n = n + 1 + until n > #t + while n < 99 + do + print(n) + end + end + print(t[i]) +end +=-=-= + +Name: Loop Indent 8 + +=-= +do +local a = b +print(a + 1) +end +=-= +do + local a = b + print(a + 1) +end +=-=-= + +Name: Bracket Indent 1 + +=-= +fn( + ) +=-= +fn( +) +=-=-= + +Name: Bracket Indent 2 + +=-= +tb={ + } +=-= +tb={ +} +=-=-= + +Name: Multi-line String Indent 1 + +=-= +local s = [[ + Multi-line + string content + ]] +=-=-= + +Name: Multi-line String Indent 2 + +=-= +function f() + local str = [[ + multi-line + string + ]] +return true +end +=-= +function f() + local str = [[ + multi-line + string + ]] + return true +end +=-=-= + +Name: Multi-line Comment Indent 1 + +=-= +--[[ + Multi-line + comment content +]] +=-=-= + +Name: Multi-line Comment Indent 2 + +=-= +function f() + --[[ + multi-line + comment + ]] + return true +end +=-=-= + +Name: Multi-line Comment Indent 3 + +=-= + --[[ + Long comment. + ]] +=-=-= + +Name: Comment Indent 1 + +=-= +local fn1 = function (a, b) +-- comment +return a + b +end +=-= +local fn1 = function (a, b) + -- comment + return a + b +end +=-=-= + +Name: Comment Indent 2 + +=-= +local tb1 = { + first = 1, +-- comment + second = 2, +} +=-= +local tb1 = { + first = 1, + -- comment + second = 2, +} +=-=-= + +Name: Comment Indent 3 + +=-= +local tb9 = { one = 1, +-- comment + two = 2 } +=-= +local tb9 = { one = 1, + -- comment + two = 2 } +=-=-= + +Name: Argument Indent 1 + +=-= +h( +"string", +1000 +) +=-= +h( + "string", + 1000 +) +=-=-= + +Name: Argument Indent 2 + +=-= +local p = h( +"string", + 1000 +) +=-= +local p = h( + "string", + 1000 +) +=-=-= + +Name: Argument Indent 3 + +=-= +fn(1, +2, + 3) +=-= +fn(1, + 2, + 3) +=-=-= + +Name: Argument Indent 4 + +=-= +fn( 1, 2, +3, 4 ) +=-= +fn( 1, 2, + 3, 4 ) +=-=-= + +Name: Argument Indent 5 + +=-= +f({ +x = 1, +y = 2, +z = 3, +}) +=-= +f({ + x = 1, + y = 2, + z = 3, +}) +=-=-= + +Name: Argument Indent 6 + +=-= +f({ x = 1, +y = 2, +z = 3, }) +=-= +f({ x = 1, + y = 2, + z = 3, }) +=-=-= + +Name: Argument Indent 7 + +=-= +Test({ +a=1 +}) +=-= +Test({ + a=1 +}) +=-=-= + +Name: Argument Indent 8 + +=-= +Test({ +a = 1, +b = 2, +}, +nil) +=-= +Test({ + a = 1, + b = 2, + }, + nil) +=-=-= + +Name: Argument Indent 9 + +=-= +Test(nil, { + a = 1, + b = 2, + }) +=-= +Test(nil, { + a = 1, + b = 2, +}) +=-=-= + +Name: Argument Indent 10 + +=-= +fn( -- comment + 1, + 2) +=-= +fn( -- comment + 1, + 2) +=-=-= + +Name: Parameter Indent 1 + +=-= +function f1( +a, +b +) +print(a,b) +end +=-= +function f1( + a, + b + ) + print(a,b) +end +=-=-= + +Name: Parameter Indent 2 + +=-= +local function f2(a, + b) +print(a,b) +end +=-= +local function f2(a, + b) + print(a,b) +end +=-=-= + +Name: Parameter Indent 3 + +=-= +local f3 = function( a, b, + c, d ) +print(a,b,c,d) +end +=-= +local f3 = function( a, b, + c, d ) + print(a,b,c,d) +end +=-=-= + +Name: Parameter Indent 4 + +=-= +local f4 = function(-- comment +a, b, c) +=-= +local f4 = function(-- comment + a, b, c) +=-=-= + +Name: Table Indent 1 + +=-= +local Other = { + First={up={Step=true,Jump=true}, + down={Step=true,Jump=true}, + left={Step=true,Jump=true}, + right={Step=true,Jump=true}}, + Second={up={Step=true,Jump=true}, + down={Step=true,Jump=true}, + left={Step=true,Jump=true}, + right={Step=true,Jump=true}}, + Third={up={Goto=true}, + down={Goto=true}, + left={Goto=true}, + right={Goto=true}} +} +=-= +local Other = { + First={up={Step=true,Jump=true}, + down={Step=true,Jump=true}, + left={Step=true,Jump=true}, + right={Step=true,Jump=true}}, + Second={up={Step=true,Jump=true}, + down={Step=true,Jump=true}, + left={Step=true,Jump=true}, + right={Step=true,Jump=true}}, + Third={up={Goto=true}, + down={Goto=true}, + left={Goto=true}, + right={Goto=true}} +} +=-=-= + +Name: Table Indent 2 + +=-= +local Other = { +a = 1, + b = 2, + c = 3, +} +=-= +local Other = { + a = 1, + b = 2, + c = 3, +} +=-=-= + +Name: Table Indent 3 + +=-= +local a = { -- hello world! + b = 10 +} +=-= +local a = { -- hello world! + b = 10 +} +=-=-= + +Name: Continuation Indent 1 + +=-= +local very_long_variable_name = +"ok".. + "ok" +=-= +local very_long_variable_name = + "ok".. + "ok" +=-=-= + +Name: Continuation Indent 2 + +=-= +local n = a + +b * +c / +1 +=-= +local n = a + + b * + c / + 1 +=-=-= + +Name: Continuation Indent 3 + +=-= +local x = "A".. +"B" +.."C" +=-= +local x = "A".. + "B" + .."C" +=-=-= + +Name: Continuation Indent 4 + +=-= +if a + and b + and c then + if x + and y then + local x = 1 + +2 * + 3 + end +elseif a + or b + or c then +end +=-= +if a + and b + and c then + if x + and y then + local x = 1 + + 2 * + 3 + end +elseif a + or b + or c then +end +=-=-= + +Code: + (lambda () + (lua-mode) + (setq-local lua-indent-level 4) + (setq-local indent-tabs-mode nil) + (indent-region (point-min) (point-max))) + +Name: End Indent 1 + +=-= +function f(x) + for y=1,x.y do + for x=1,x.z do + if x.y and x.z then + if y <= x then + y = y + 1 + end end end end + return {x,y} or {math.random(),math.random()} + end +=-= +function f(x) + for y=1,x.y do + for x=1,x.z do + if x.y and x.z then + if y <= x then + y = y + 1 + end end end end + return {x,y} or {math.random(),math.random()} +end +=-=-= + +Name: End Indent 2 + +=-= +for y=1,x.y do + for x=1,x.z do + if x.y and x.z then + if y <= x then + y = y + 1 + end + end end end +=-= +for y=1,x.y do + for x=1,x.z do + if x.y and x.z then + if y <= x then + y = y + 1 + end +end end end +=-=-= + +Name: Nested Function Indent 1 + +=-= +function a(...) +return (function (x) +return x +end)(foo(...)) +end +=-= +function a(...) + return (function (x) + return x + end)(foo(...)) +end +=-=-= + +Name: Nested Function Indent 2 + +=-= +function b(n) +local x = 1 +return function (i) +return function (...) +return (function (n, ...) +return function (f, ...) +return (function (...) +if ... and x < 9 then +x = x + 1 +return ... +end end)(n(f, ...)) +end, ... +end)(i(...)) +end end end +=-= +function b(n) + local x = 1 + return function (i) + return function (...) + return (function (n, ...) + return function (f, ...) + return (function (...) + if ... and x < 9 then + x = x + 1 + return ... + end end)(n(f, ...)) + end, ... + end)(i(...)) +end end end +=-=-= + +Name: Nested Function Indent 3 + +=-= +function c(f) +local f1 = function (...) +if nil ~= ... then +return f(...) +end +end +return function (i) +return function (...) +local fn = function (n, ...) +local x = function (f, ...) +return f1(n(f, ...)) +end +return x +end +return fn(i(...)) +end +end +end +=-= +function c(f) + local f1 = function (...) + if nil ~= ... then + return f(...) + end + end + return function (i) + return function (...) + local fn = function (n, ...) + local x = function (f, ...) + return f1(n(f, ...)) + end + return x + end + return fn(i(...)) + end + end +end +=-=-= + +Name: Nested Function Indent 4 + +=-= +function d(f) +local f1 = function (c, f, ...) +if ... then +if f(...) then +return ... +else +return c(f, ...) +end end end +return function (i) +return function (...) +return (function (n, ...) +local function j (f, ...) +return f1(j, f, n(f, ...)) +end +return j, ... +end)(i(...)) +end end end +=-= +function d(f) + local f1 = function (c, f, ...) + if ... then + if f(...) then + return ... + else + return c(f, ...) + end end end + return function (i) + return function (...) + return (function (n, ...) + local function j (f, ...) + return f1(j, f, n(f, ...)) + end + return j, ... + end)(i(...)) +end end end +=-=-= + +Name: Nested Function Indent 5 + +=-= +function e (n, t) +return function (i) +return function (...) +return ( +function (n, ...) +local x, y, z = 0, {} +return (function (f, ...) +return (function (i, ...) return i(i, ...) end)( +function (i, ...) +return f(function (x, ...) +return i(i, ...)(x, ...) +end, ...) +end) +end)(function (j) +return function(f, ...) +return (function (c, f, ...) +if ... then +if n+1 == x then +local y1, x1 = y, x +y, x = {}, 0 +return (function (...) +z = ... +return ... +end)(t(y1-1, x1-1, ...)) +else +x = x - 1 +return c(f, +(function (...) +z = ... +return ... +end)(t(y, x, ...))) +end +elseif x ~= 0 then +x = 0 +return z, y +end end)(j, f, n(f, ...)) +end end), ... +end)(i(...)) +end end end +=-= +function e (n, t) + return function (i) + return function (...) + return ( + function (n, ...) + local x, y, z = 0, {} + return (function (f, ...) + return (function (i, ...) return i(i, ...) end)( + function (i, ...) + return f(function (x, ...) + return i(i, ...)(x, ...) + end, ...) + end) + end)(function (j) + return function(f, ...) + return (function (c, f, ...) + if ... then + if n+1 == x then + local y1, x1 = y, x + y, x = {}, 0 + return (function (...) + z = ... + return ... + end)(t(y1-1, x1-1, ...)) + else + x = x - 1 + return c(f, + (function (...) + z = ... + return ... + end)(t(y, x, ...))) + end + elseif x ~= 0 then + x = 0 + return z, y + end end)(j, f, n(f, ...)) + end end), ... + end)(i(...)) +end end end +=-=-= diff --git a/test/lisp/progmodes/lua-mode-resources/movement.erts b/test/lisp/progmodes/lua-mode-resources/movement.erts new file mode 100644 index 00000000000..04a52e6bd01 --- /dev/null +++ b/test/lisp/progmodes/lua-mode-resources/movement.erts @@ -0,0 +1,637 @@ +Code: + (lambda () + (lua-mode) + (beginning-of-defun 1)) + +Point-Char: | + +Name: beginning-of-defun moves to start of function declaration + +=-= +local function Test() + if true then + print(1) + else + print(0) + end| +end +=-= +|local function Test() + if true then + print(1) + else + print(0) + end +end +=-=-= + +Code: + (lambda () + (lua-mode) + (end-of-defun 1)) + +Point-Char: | + +Name: end-of-defun moves to end of function declaration + +=-= +local function Test() + if true then + pr|int(1) + else + print(0) + end +end + +local t = Test() +=-= +local function Test() + if true then + print(1) + else + print(0) + end +end +| +local t = Test() +=-=-= + +Name: end-of-defun moves to end of function definition + +=-= +local t = { + f = function() + re|turn true + end, +} +=-= +local t = { + f = function() + return true +| end, +} +=-=-= + +Code: + (lambda () + (lua-mode) + (forward-sentence 1)) + +Point-Char: | + +Name: forward-sentence moves over if statements + +=-= +function f() + |if true then + print(1) + elseif false then + print(0) + else + print(2) + end +end +=-= +function f() + if true then + print(1) + elseif false then + print(0) + else + print(2) + end +end| +=-=-= + +Name: forward-sentence moves over variable declaration + +=-= +|local n = 1 + +print(n) +=-= +local n = 1| + +print(n) +=-=-= + +Name: forward-sentence moves over for statements + +=-= +|for k, v in pairs({}) do + print(k, v) +end + +print(1) +=-= +for k, v in pairs({}) do + print(k, v) +end| + +print(1) +=-=-= + +Name: forward-sentence moves over do statements + +=-= +|do + local x = 1 + local y = 2 + + print(x, y) +end + +print(1) +=-= +do + local x = 1 + local y = 2| + + print(x, y) +end + +print(1) +=-=-= + +Name: forward-sentence moves over while statements + +=-= +local i = 0 +|while i < 9 do + print(i) + i = i + 1 +end + +print(1) +=-= +local i = 0 +while i < 9 do + print(i) + i = i + 1 +end| + +print(1) +=-=-= + +Name: forward-sentence moves over repeat statements + +=-= +local i = 0 +|repeat + print(i) + i = i + 1 +until i > 9 + +print(1) +=-= +local i = 0 +repeat + print(i) + i = i + 1 +until i > 9| + +print(1) +=-=-= + +Name: forward-sentence moves over function calls + +=-= +|print(1) +=-= +print(1)| +=-=-= + +Name: forward-sentence moves over return statements + +=-= +function f() + |return math.random() +end +=-= +function f() + return math.random() +end| +=-=-= + +Code: + (lambda () + (lua-mode) + (forward-sentence 1)) + +Name: forward-sentence moves over table fields + +=-= +local t = { + |a = 1, + b = 2, +} +=-= +local t = { + a = 1, + b = 2, +}| +=-=-= + +Code: + (lambda () + (lua-mode) + (backward-sentence 1)) + +Point-Char: | + +Name: backward-sentence moves over if statements + +=-= +function f() + if true then + print(1) + elseif false then + print(0) + else + print(2) + end| +end +=-= +|function f() + if true then + print(1) + elseif false then + print(0) + else + print(2) + end +end +=-=-= + +Name: backward-sentence moves over variable declaration + +=-= +local n = 1| + +print(n) +=-= +|local n = 1 + +print(n) +=-=-= + +Name: backward-sentence moves over for statements + +=-= +for k, v in pairs({}) do + print(k, v) +end| + +print(1) +=-= +|for k, v in pairs({}) do + print(k, v) +end + +print(1) +=-=-= + +Name: backward-sentence moves over do statements + +=-= +do + local x = 1 + local y = 2 + + print(x, y) +end| + +print(1) +=-= +do + local x = 1 + local y = 2 + + |print(x, y) +end + +print(1) +=-=-= + +Name: backward-sentence moves over while statements + +=-= +local i = 0 +while i < 9 do + print(i) + i = i + 1 +end| + +print(1) +=-= +|local i = 0 +while i < 9 do + print(i) + i = i + 1 +end + +print(1) +=-=-= + +Name: backward-sentence moves over repeat statements + +=-= +local i = 0 +repeat + print(i) + i = i + 1 +until i > 9| + +print(1) +=-= +|local i = 0 +repeat + print(i) + i = i + 1 +until i > 9 + +print(1) +=-=-= + +Name: backward-sentence moves over function calls + +=-= +print(1)| +=-= +|print(1) +=-=-= + +Name: backward-sentence moves over return statements + +=-= +function f() + return math.random()| +end +=-= +|function f() + return math.random() +end +=-=-= + +Code: + (lambda () + (lua-mode) + (backward-sentence 2)) + +Point-Char: | + +Name: backward-sentence moves over table fields + +=-= +local t = { + a = 1, + b = 2|, +} +=-= +|local t = { + a = 1, + b = 2, +} +=-=-= + +Code: + (lambda () + (lua-mode) + (forward-sexp 1)) + +Point-Char: | + +Name: forward-sexp moves over arguments + +=-= +print|(1, 2, 3) +=-= +print(1, 2, 3)| +=-=-= + +Name: forward-sexp moves over parameters + +=-= +function f|(a, b) end +=-= +function f(a, b)| end +=-=-= + +Name: forward-sexp moves over strings + +=-= +print(|"1, 2, 3") +=-= +print("1, 2, 3"|) +=-=-= + +Name: forward-sexp moves over tables + +=-= +local t = |{ 1, + 2, + 3 } +=-= +local t = { 1, + 2, + 3 }| +=-=-= + +Name: forward-sexp moves over parenthesized expressions + +=-= +|(function (x) return x + 1 end)(41) +=-= +(function (x) return x + 1 end)|(41) +=-=-= + +Name: forward-sexp moves over function declarations + +=-= +|function foo (x) + if false then + print "foo" + elseif true then + print "bar" + end +end +=-= +function| foo (x) + if false then + print "foo" + elseif true then + print "bar" + end +end +=-=-= + +Name: forward-sexp moves over do statements + +=-= +|do + print(a + 1) +end +=-= +do| + print(a + 1) +end +=-=-= + +Name: forward-sexp moves over for statements + +=-= +|for k,v in pairs({}) do + print(k, v) +end +=-= +for| k,v in pairs({}) do + print(k, v) +end +=-=-= + +Name: forward-sexp moves over repeat statements + +=-= +|repeat + n = n + 1 +until n > 10 +=-= +repeat| + n = n + 1 +until n > 10 +=-=-= + +Name: forward-sexp moves over while statements + +=-= +|while n < 99 +do + n = n+1 +end +=-= +while| n < 99 +do + n = n+1 +end +=-=-= + +Code: + (lambda () + (lua-mode) + (backward-sexp 1)) + +Point-Char: | + +Name: backward-sexp moves over arguments + +=-= +print(1, 2, 3)| +=-= +print|(1, 2, 3) +=-=-= + +Name: backward-sexp moves over parameters + +=-= +function f(a, b)| end +=-= +function f|(a, b) end +=-=-= + +Name: backward-sexp moves over strings + +=-= +print("1, 2, 3"|) +=-= +print(|"1, 2, 3") +=-=-= + +Name: backward-sexp moves over tables + +=-= +local t = { 1, + 2, + 3 }| +=-= +local t = |{ 1, + 2, + 3 } +=-=-= + +Name: backward-sexp moves over parenthesized expressions + +=-= +(function (x) return x + 1 end)|(41) +=-= +|(function (x) return x + 1 end)(41) +=-=-= + +Name: backward-sexp moves over function declarations + +=-= +function foo (x) + if false then + print "foo" + elseif true then + print "bar" + end +end| +=-= +function foo (x) + if false then + print "foo" + elseif true then + print "bar" + end +|end +=-=-= + +Name: backward-sexp moves over do statements + +=-= +do + print(a + 1) +end| +=-= +do + print(a + 1) +|end +=-=-= + +Name: backward-sexp moves over for statements + +=-= +for k,v in pairs({}) do + print(k, v) +end| +=-= +for k,v in pairs({}) do + print(k, v) +|end +=-=-= + +Name: backward-sexp moves over repeat statements + +=-= +repeat + n = n + 1 +until n > 10| +=-= +repeat + n = n + 1 +until n > |10 +=-=-= + +Name: backward-sexp moves over while statements + +=-= +while n < 99 +do + n = n+1 +end| +=-= +while n < 99 +do + n = n+1 +|end +=-=-= diff --git a/test/lisp/progmodes/lua-mode-resources/which-function.lua b/test/lisp/progmodes/lua-mode-resources/which-function.lua new file mode 100644 index 00000000000..621d818461c --- /dev/null +++ b/test/lisp/progmodes/lua-mode-resources/which-function.lua @@ -0,0 +1,3 @@ +local function f(x) + print(x) +end diff --git a/test/lisp/progmodes/lua-mode-tests.el b/test/lisp/progmodes/lua-mode-tests.el new file mode 100644 index 00000000000..aee3a5f47cb --- /dev/null +++ b/test/lisp/progmodes/lua-mode-tests.el @@ -0,0 +1,60 @@ +;;; lua-mode-tests.el --- Tests for lua-mode -*- lexical-binding: t; -*- + +;; Copyright (C) 2023-2025 Free Software Foundation, Inc. + +;; This file is part of GNU Emacs. + +;; GNU Emacs is free software: you can redistribute it and/or modify +;; it under the terms of the GNU General Public License as published by +;; the Free Software Foundation, either version 3 of the License, or +;; (at your option) any later version. + +;; GNU Emacs is distributed in the hope that it will be useful, +;; but WITHOUT ANY WARRANTY; without even the implied warranty of +;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +;; GNU General Public License for more details. + +;; You should have received a copy of the GNU General Public License +;; along with GNU Emacs. If not, see <https://www.gnu.org/licenses/>. + +;;; Code: + +(require 'ert) +(require 'ert-font-lock) +(require 'ert-x) +(require 'hideshow) +(require 'which-func) + +(ert-deftest lua-test-indentation () + (ert-test-erts-file (ert-resource-file "indent.erts"))) + +(ert-deftest lua-test-movement () + (ert-test-erts-file (ert-resource-file "movement.erts"))) + +(ert-deftest lua-test-font-lock () + (let ((font-lock-maximum-decoration t)) + (ert-font-lock-test-file (ert-resource-file "font-lock.lua") 'lua-mode))) + +(ert-deftest lua-test-which-function () + (with-temp-buffer + (insert-file-contents (ert-resource-file "which-function.lua")) + (lua-mode) + (which-function-mode) + (goto-char (point-min)) + (should (equal "f" (which-function))) + (which-function-mode -1))) + +(ert-deftest lua-test-hideshow () + (with-temp-buffer + (insert-file-contents (ert-resource-file "hide-show.lua")) + (lua-mode) + (hs-minor-mode) + (hs-hide-all) + (should (= 9 (length (overlays-in (point-min) (point-max))))) + (hs-show-all) + (should (= 0 (length (overlays-in (point-min) (point-max))))) + (hs-minor-mode -1))) + +(provide 'lua-mode-tests) + +;;; lua-mode-tests.el ends here -- 2.48.1 --=-=-=--
Received: (at control) by debbugs.gnu.org; 23 Mar 2025 12:36:35 +0000 From debbugs-submit-bounces <at> debbugs.gnu.org Sun Mar 23 08:36:35 2025 Received: from localhost ([127.0.0.1]:48082 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from <debbugs-submit-bounces <at> debbugs.gnu.org>) id 1twKZ8-0001VO-St for submit <at> debbugs.gnu.org; Sun, 23 Mar 2025 08:36:35 -0400 Received: from mail-ed1-x52f.google.com ([2a00:1450:4864:20::52f]:54608) by debbugs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.84_2) (envelope-from <stefankangas@HIDDEN>) id 1twKZ6-0001UR-Bb for control <at> debbugs.gnu.org; Sun, 23 Mar 2025 08:36:33 -0400 Received: by mail-ed1-x52f.google.com with SMTP id 4fb4d7f45d1cf-5dca468c5e4so5920062a12.1 for <control <at> debbugs.gnu.org>; Sun, 23 Mar 2025 05:36:32 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1742733385; x=1743338185; darn=debbugs.gnu.org; h=to:subject:message-id:date:mime-version:from:from:to:cc:subject :date:message-id:reply-to; bh=joFKiuxmmYmmMyhUdCUuPF9JjYjLqVM52E1rDUX3ecg=; b=ieID/RIs+TXXPddY6zx9hh60hh+kdtLqoRZKzyUYswK2Gx4Tf6I8hWyzaDBbBGUt20 CvsKiElnOXognO+AxzWjDL3HQHenk/m4nugwdiH7LeVdoZNtLjATX2AAmX4chHcbpCTw wvm/296pIjiWiUNaoiJp0LK7f9P0B8eIrZ7eT3AT/MkdWAWvAmfNNmkzQ8MS0TChlC6J A46kzScViFLr42XF220u2+E1rypOn2kUAc0szivLE8g9I4DLB+JeRuRhg4LaI90Uhq34 m57zHpoaMG6h9I6mJSXSzdsnVBaMF7ndTl8O/E0Ibit7Kf0sC8mEI7wI1Sc1znIlp/9I ibwg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1742733385; x=1743338185; h=to:subject:message-id:date:mime-version:from:x-gm-message-state :from:to:cc:subject:date:message-id:reply-to; bh=joFKiuxmmYmmMyhUdCUuPF9JjYjLqVM52E1rDUX3ecg=; b=m+KTsHZni8Y7oB9YzgQWeEXzxo5qDssuSRjUmvSJe9JjMKGn91+EAKhk5F7dr4sH6g notYniE3F2HiyC4HG5OkLABBljQOL0/hRJaM2LN36KzMR+zubGM4RhgLD3kxxdqKsavV ZIAdVHGdj66beQ2lNtvecZEapy/giSdY4W9v93AQIiryjHjKRWJhw7uKEWk7QHTKM9rB YUgbHP1NW1PyA8jaS5qHkn3521eIK8HkSuA71Zhuxt+l6OyU0LvJOaot3m1LnHJqTajc DBY4lMeZci+1Pl9ak8tZ0zu3OETIP6NW/6F36dx9wnmL9wObBmPvs11b+joacmzEms9m RK1A== X-Gm-Message-State: AOJu0YxN9OWQB/LJ+4kHbq+BgX4PqQG2xWyBuOUWp6vwtBZ3FjaOu4hn urUlRhec1C6tSLxmNfN0syO6iVfBe+Bpr4V3HAmR2tx5FocdA/Wor/JVZZPILrCSf8qeXlc2wAR J0HGMysSei/CH6b/OzUVNJWSUQkYgfiiv X-Gm-Gg: ASbGncu1XkzLip2xiswyjwexjIzwcBppPCZGWLG/xKarhQu5xfylJGrWdNw149yOWs3 7H9EqwxD9eoA65bboYiv5fDODuZhN25NiXmjH8rFvucV9qQBCJWRtFn3KiW2m5SnEThv39X+N6O 0Ae8zjBkJQJ0PsP8Kr827KJD5SSiPDSfLi3TAF2g== X-Google-Smtp-Source: AGHT+IG/rBnFREgaPrmSpch71Z/OsGTHsb68R09YJmGxgD4bUGSLHJ+6D9+KPZQJXfQz6Enb07rLK6+Vi3Jrn3rxMk8= X-Received: by 2002:a05:6402:4314:b0:5e6:1867:3f7e with SMTP id 4fb4d7f45d1cf-5ebcd51c59emr7178740a12.32.1742733385534; Sun, 23 Mar 2025 05:36:25 -0700 (PDT) Received: from 753933720722 named unknown by gmailapi.google.com with HTTPREST; Sun, 23 Mar 2025 12:36:25 +0000 From: Stefan Kangas <stefankangas@HIDDEN> MIME-Version: 1.0 Date: Sun, 23 Mar 2025 12:36:25 +0000 X-Gm-Features: AQ5f1JqUrK3FySq5JC1L4s1ljegzDa1DFWbC4ZGDWybP5S8cz2YpgpOeqps4bac Message-ID: <CADwFkmnaNupP0r+Nkj0SjvmvhB0Ty1BrzcHobj2VxdtJmgsQkg@HIDDEN> Subject: control message for bug #76650 To: control <at> debbugs.gnu.org Content-Type: text/plain; charset="UTF-8" X-Spam-Score: 0.0 (/) X-Debbugs-Envelope-To: control X-BeenThere: debbugs-submit <at> debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list List-Id: <debbugs-submit.debbugs.gnu.org> List-Unsubscribe: <https://debbugs.gnu.org/cgi-bin/mailman/options/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=unsubscribe> List-Archive: <https://debbugs.gnu.org/cgi-bin/mailman/private/debbugs-submit/> List-Post: <mailto:debbugs-submit <at> debbugs.gnu.org> List-Help: <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=help> List-Subscribe: <https://debbugs.gnu.org/cgi-bin/mailman/listinfo/debbugs-submit>, <mailto:debbugs-submit-request <at> debbugs.gnu.org?subject=subscribe> Errors-To: debbugs-submit-bounces <at> debbugs.gnu.org Sender: "Debbugs-submit" <debbugs-submit-bounces <at> debbugs.gnu.org> X-Spam-Score: -1.0 (-) tags 76650 + patch quit
GNU bug tracking system
Copyright (C) 1999 Darren O. Benham,
1997 nCipher Corporation Ltd,
1994-97 Ian Jackson.